• Gene id: 4609

Gene Summary

• Gene Symbol: MYC   Gene   UCSC   Ensembl
• Aliases: MRTL, MYCC, bHLHe39, c-Myc
• Gene name: MYC proto-oncogene, bHLH transcription factor
• Alternate names: myc proto-oncogene protein, avian myelocytomatosis viral oncogene homolog, class E basic helix-loop-helix protein 39, myc-related translation/localization regulatory factor, proto-oncogene c-Myc, transcription factor p64, v-myc avian myelocytomatosis vira,
• Gene location: 8q24.21 (127735433: 127742950)     Exons: 3     NC_000008.11
• Gene summary(Entrez): This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to
• OMIM: 190080

Protein Summary

• Protein general information: P01106  
  • Name: Myc proto oncogene protein (Class E basic helix loop helix protein 39) (bHLHe39) (Proto oncogene c Myc) (Transcription factor p64)
  • Length: 439  
  • Mass: 48,804
• Sequence:

  MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYV
  AVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLA
  SYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
  STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
  HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFF
  ALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

• Structural information:
  • Protein Domains: bHLH. (354-406)
  • Interpro: IPR011598  IPR036638  IPR003327  IPR002418  IPR012682  
  • Prosite: PS50888
  • CDD: cd00083
  • PDB: 1A93 1EE4 1MV0 1NKP 2A93 2OR9 4Y7R 5I4Z 5I50
  • PDBsum: 1A93 1EE4 1MV0 1NKP 2A93 2OR9 4Y7R 5I4Z 5I50
  • DIP: 28143
  • STRING: ENSP00000367207
• Other Databases: GeneCards:  MYC  Malacards:  MYC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	IDA	molecular function
GO:0001658	branching involved in ureteric bud morphogenesis	ISS	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	ISS	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006112	energy reserve metabolic process	NAS	biological process
GO:0006338	chromatin remodeling	IDA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0010332	response to gamma radiation	IDA	biological process
GO:0010468	regulation of gene expression	IDA	biological process
GO:0015671	oxygen transport	NAS	biological process
GO:0032204	regulation of telomere maintenance	IMP	biological process
GO:0032403	protein complex binding	IDA	molecular function
GO:0032873	negative regulation of stress-activated MAPK cascade	ISS	biological process
GO:0034644	cellular response to UV	IEP	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0042493	response to drug	IEP	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0044346	fibroblast apoptotic process	TAS	biological process
GO:0045656	negative regulation of monocyte differentiation	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IMP	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0051276	chromosome organization	IDA	biological process
GO:0051782	negative regulation of cell division	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0070848	response to growth factor	TAS	biological process
GO:0070888	E-box binding	IDA	molecular function
GO:0090096	positive regulation of metanephric cap mesenchymal cell proliferation	ISS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IMP	biological process
GO:2001022	positive regulation of response to DNA damage stimulus	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	IDA	molecular function
GO:0001658	branching involved in ureteric bud morphogenesis	ISS	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	ISS	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006112	energy reserve metabolic process	NAS	biological process
GO:0006338	chromatin remodeling	IDA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0010332	response to gamma radiation	IDA	biological process
GO:0010468	regulation of gene expression	IDA	biological process
GO:0015671	oxygen transport	NAS	biological process
GO:0032204	regulation of telomere maintenance	IMP	biological process
GO:0032403	protein complex binding	IDA	molecular function
GO:0032873	negative regulation of stress-activated MAPK cascade	ISS	biological process
GO:0034644	cellular response to UV	IEP	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0042493	response to drug	IEP	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0044346	fibroblast apoptotic process	TAS	biological process
GO:0045656	negative regulation of monocyte differentiation	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IMP	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0051276	chromosome organization	IDA	biological process
GO:0051782	negative regulation of cell division	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0070848	response to growth factor	TAS	biological process
GO:0070888	E-box binding	IDA	molecular function
GO:0090096	positive regulation of metanephric cap mesenchymal cell proliferation	ISS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IMP	biological process
GO:2001022	positive regulation of response to DNA damage stimulus	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	IDA	molecular function
GO:0001658	branching involved in ureteric bud morphogenesis	ISS	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	ISS	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006112	energy reserve metabolic process	NAS	biological process
GO:0006338	chromatin remodeling	IDA	biological process
GO:0006879	cellular iron ion homeostasis	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0010332	response to gamma radiation	IDA	biological process
GO:0010468	regulation of gene expression	IDA	biological process
GO:0015671	oxygen transport	NAS	biological process
GO:0032204	regulation of telomere maintenance	IMP	biological process
GO:0032403	protein complex binding	IDA	molecular function
GO:0032873	negative regulation of stress-activated MAPK cascade	ISS	biological process
GO:0034644	cellular response to UV	IEP	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0042493	response to drug	IEP	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0044346	fibroblast apoptotic process	TAS	biological process
GO:0045656	negative regulation of monocyte differentiation	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0048146	positive regulation of fibroblast proliferation	IMP	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0051276	chromosome organization	IDA	biological process
GO:0051782	negative regulation of cell division	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0070848	response to growth factor	TAS	biological process
GO:0070888	E-box binding	IDA	molecular function
GO:0090096	positive regulation of metanephric cap mesenchymal cell proliferation	ISS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IMP	biological process
GO:2001022	positive regulation of response to DNA damage stimulus	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa00500	Starch and sucrose metabolism
hsa00520	Amino sugar and nucleotide sugar metabolism
hsa00620	Pyruvate metabolism
hsa00620	Pyruvate metabolism
hsa00630	Glyoxylate and dicarboxylate metabolism
hsa00562	Inositol phosphate metabolism
hsa00140	Steroid hormone biosynthesis
hsa00230	Purine metabolism
hsa00270	Cysteine and methionine metabolism
hsa00330	Arginine and proline metabolism
hsa03013	RNA transport
hsa04120	Ubiquitin mediated proteolysis
hsa03050	Proteasome
hsa03018	RNA degradation
hsa03410	Base excision repair
hsa03430	Mismatch repair
hsa03460	Fanconi anemia pathway
hsa02010	ABC transporters
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04015	Rap1 signaling pathway
hsa04350	TGF-beta signaling pathway
hsa04390	Hippo signaling pathway
hsa04390	Hippo signaling pathway
hsa04370	VEGF signaling pathway
hsa04371	Apelin signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04110	Cell cycle
hsa04218	Cellular senescence
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04919	Thyroid hormone signaling pathway
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05230	Central carbon metabolism in cancer
hsa05210	Colorectal cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05216	Thyroid cancer
hsa05221	Acute myeloid leukemia
hsa05220	Chronic myeloid leukemia
hsa05219	Bladder cancer
hsa05213	Endometrial cancer
hsa05224	Breast cancer
hsa05222	Small cell lung cancer
hsa05166	Human T-cell leukemia virus 1 infection
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection

Diseases

Associated diseases	References
Cancer	GAD: 2509518
Cancer (bladder)	GAD: 19692168
Cancer (colorectal)	GAD: 7574421
Cancer (Hepatocellular)	GAD: 9135021
Cancer (large B-cell lymphoma)	GAD: 11182042
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 9196434
Cancer (non-Hodgkin lymphoma)	GAD: 2509518
Cancer (ovarian)	GAD: 20852632
Cancer (prostate)	GAD: 18483343
Cancer (Squamous cell)	GAD: 19596922
Cancer (stomach)	GAD: 15991278
Cancer (thyroid)	GAD: 19730683
Cancer (urinary bladder)	GAD: 18794855
Cancer (breast)	GAD: 15929079
T lymphoblastic leukemia	KEGG: H00002
Cancer (oral)	KEGG: H00016
Cancer (breast)	KEGG: H00031
Cancer (small cell lung)	KEGG: H00013
Medulloblastoma	KEGG: H01667
Choriocarcinoma	KEGG: H00028
Cancer (penile)	KEGG: H00025
Osteosarcoma	KEGG: H00036
Cancer (ovarian)	KEGG: H00027
Kaposi's sarcoma	KEGG: H00041
Cancer (Laryngeal)	KEGG: H00055
Cancer (tonsillar)	KEGG: H01509
B lymphoblastic leukemia	KEGG: H00001
Cancer (Fallopian tube)	KEGG: H01554
Multiple myeloma	KEGG: H00010
Hodgkin disease	GAD: 19573080
Burkitt lymphoma	KEGG: H00008
Alzheimer's disease	GAD: 19141999
Chronic renal failure	GAD: 21085059
Ovarian endometriosis	INFBASE: 23006437
Male factor infertility	MIK: 22771312
Male factor infertility	MIK: 22771312
Endometriosis	INFBASE: 25546156
Endometriosis	INFBASE: 22884659
Female infertility	INFBASE: 16150151
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Induces apoptosis at the prophase meiosis of the primary spermatocytes thereby causing male sterility	MIK: 8956277
Male infertility	MIK: 22771312
May have a role in sperm cell function especially in capacitation and/or acrosome reaction	MIK: 1868142

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22771312	Male infertility				Male infertility	TGF-?1 MYC MYCN and TP53
8956277	Induces apoptosis at the prophase meiosis of the primary spermatocytes thereby causing male sterility				Male infertility
1868142	May have a role in sperm cell function especially in capacitation and/or acrosome reaction				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881