• Gene id: 4600

Gene Summary

• Gene Symbol: MX2   Gene   UCSC   Ensembl
• Aliases: MXB
• Gene name: MX dynamin like GTPase 2
• Alternate names: interferon-induced GTP-binding protein Mx2, interferon-regulated resistance GTP-binding protein MXB, myxovirus (influenza virus) resistance 2, myxovirus resistance protein 2, p78-related protein, second interferon-induced protein p78,
• Gene location: 21q22.3 (41361943: 41409392)     Exons: 18     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelop
• OMIM: 300621

Protein Summary

• Protein general information: P20592  
  • Name: Interferon induced GTP binding protein Mx2 (Interferon regulated resistance GTP binding protein MxB) (Myxovirus resistance protein 2) (p78 related protein)
  • Length: 715  
  • Mass: 82089
• Sequence:

  MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPG
  NRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIV
  TRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIID
  LPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMD
  RGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFFQTHPYFRVLLEEGSATVPRLAERLT
  TELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRL
  YNKIREDFKNWVGILATNTQKVKNIIHEEVEKYEKQYRGKELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAME
  IIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPL
  GTPSQNMKLNSHFPSNESSVSSFTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRY
  SWLLQEQSETATKRRILKERIYRLTQARHALCQFSSKEIH

• Structural information:
  • Protein Domains: (115..38-)
    (/note="Dynamin-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01055-)
    (623..71-)
    (/note="GED-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00720"-)
  • Interpro: IPR000375  IPR001401  IPR019762  IPR022812  IPR030381   IPR003130  IPR020850  IPR027417  
  • Prosite: PS00410 PS51718 PS51388
  • CDD: cd08771
  • PDB: 4WHJ 4X0R 5UOT
  • PDBsum: 4WHJ 4X0R 5UOT
  • DIP: 59212
  • STRING: ENSP00000333657
• Other Databases: GeneCards:  MX2  Malacards:  MX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0031623	receptor internalization	IBA	biological process
GO:0031966	mitochondrial membrane	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0044327	dendritic spine head	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0048285	organelle fission	IBA	biological process
GO:0098844	postsynaptic endocytic zone membrane	IBA	cellular component
GO:0098884	postsynaptic neurotransmitter receptor internalization	IBA	biological process
GO:0000266	mitochondrial fission	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0008017	microtubule binding	IBA	molecular function
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0016185	synaptic vesicle budding from presynaptic endocytic zone membrane	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0050803	regulation of synapse structure or activity	IBA	biological process
GO:0061025	membrane fusion	IBA	biological process
GO:0035455	response to interferon-alpha	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0005643	nuclear pore	IDA	cellular component
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0046822	regulation of nucleocytoplasmic transport	IMP	biological process
GO:0005525	GTP binding	IMP	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006952	defense response	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq