• Gene id: 4591

Gene Summary

• Gene Symbol: TRIM37   Gene   UCSC   Ensembl
• Aliases: MUL, POB1, TEF3
• Gene name: tripartite motif containing 37
• Alternate names: E3 ubiquitin-protein ligase TRIM37, RING-B-box-coiled-coil protein, RING-type E3 ubiquitin transferase TRIM37, mulibrey nanism protein,
• Gene location: 17q22 (59106879: 58968009)     Exons: 28     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif
• OMIM: 605073

Protein Summary

• Protein general information: O94972  
  • Name: E3 ubiquitin protein ligase TRIM37 (EC 2.3.2.27) (Mulibrey nanism protein) (RING type E3 ubiquitin transferase TRIM37) (Tripartite motif containing protein 37)
  • Length: 964  
  • Mass: 107906
  • Tissue specificity: Ubiquitous (PubMed
• Sequence:

  MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQ
  LDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALWGGMHGGHTFKPLAEIYEQHVTKVNEEVAKL
  RRRLMELISLVQEVERNVEAVRNAKDERVREIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEV
  EHQLRSCSKSELISKSSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP
  LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNIIREFASDFEVGECWGY
  NRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYITQLEAAQTSYIQQINNLKERLTIELSRTQKS
  RDLSPPDNHLSPQNDDALETRAKKSACSDMLLEGGPTTASVREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYE
  DEVNQLDGSSSSASSTATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRR
  THLCSAATSSLLDIDPLILIHLLDLKDRSSIENLWGLQPRPPASLLQPTASYSRKDKDQRKQQAMWRVPSDLKML
  KRLKTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAALAACGTENSGRLQDLGMELLAKSSVANCYI
  RNSTNKKSNSPKPARSSVAGSLSLRRAVDPGENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKT
  EDRQCKALDSDAVVVAVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGM
  SSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR

• Structural information:
  • Protein Domains: (276..40-)
    (/note="MATH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00129"-)
  • Interpro: IPR003649  IPR002083  IPR008974  IPR037299  IPR000315   IPR001841  IPR013083  
  • Prosite: PS50144 PS50119 PS50089
  • CDD: cd00021 cd03773
  • PDB: 3LRQ
  • PDBsum: 3LRQ
  • DIP: 34437
  • STRING: ENSP00000262294
• Other Databases: GeneCards:  TRIM37  Malacards:  TRIM37

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005164	tumor necrosis factor receptor binding	IBA	molecular function
GO:0005777	peroxisome	IBA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0036353	histone H2A-K119 monoubiquitination	IBA	biological process
GO:0046600	negative regulation of centriole replication	IBA	biological process
GO:0051865	protein autoubiquitination	IBA	biological process
GO:0016235	aggresome	IBA	cellular component
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0035098	ESC/E(Z) complex	IDA	colocalizes with
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0036353	histone H2A-K119 monoubiquitination	IDA	biological process
GO:0035518	histone H2A monoubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0046600	negative regulation of centriole replication	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0036353	histone H2A-K119 monoubiquitination	IEA	biological process
GO:0035518	histone H2A monoubiquitination	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0070842	aggresome assembly	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0016235	aggresome	IDA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005164	tumor necrosis factor receptor binding	IPI	molecular function
GO:0005164	tumor necrosis factor receptor binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005164	tumor necrosis factor receptor binding	IPI	molecular function
GO:0005164	tumor necrosis factor receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Mulibrey nanism	KEGG:H01289
Mulibrey nanism	KEGG:H01289
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R