• Gene id: 4580

Gene Summary

• Gene Symbol: MTX1   Gene   UCSC   Ensembl
• Aliases: MTX, MTXN
• Gene name: metaxin 1
• Alternate names: metaxin-1, mitochondrial outer membrane import complex protein 1,
• Gene location: 1q22 (155208698: 155213838)     Exons: 8     NC_000001.11
• OMIM: 600605

Protein Summary

• Protein general information: Q13505  
  • Name: Metaxin 1 (Mitochondrial outer membrane import complex protein 1)
  • Length: 466  
  • Mass: 51463
• Sequence:

  MLLGGPPRSPRSGTSPKGPWSSTGHVQFGKSPQTWPRRTRPRSPEPAAPSGVRGSTWTRRRDSPRRAGPTALSRY
  VGHLWMGRRPPSPEARGPVPRSSAASRARRSLASPGISPGPLTATIGGAVAGGGPRQGRAEAHKEVFPGQRVGKM
  AAPMELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHGEVISVPHKIITHLRK
  EKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERL
  QLLTGEHRPEDEEELEKELYREARECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG
  LHNLCAYCTHILSLYFPWDGAEVPPQRQTPAGPETEEEPYRRRNQILSVLAGLAAMVGYALLSGIVSIQRATPAR
  APGTRTLGMAEEDEEE

• Structural information:
  • Interpro: IPR036282  IPR040079  IPR033468  IPR019564  
  • STRING: ENSP00000357360
• Other Databases: GeneCards:  MTX1  Malacards:  MTX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001401	SAM complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0007595	lactation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0007007	inner mitochondrial membrane organization	IC	biological process
GO:0001401	SAM complex	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0140275	MIB complex	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)