• Gene id: 4542

Gene Summary

• Gene Symbol: MYO1F   Gene   UCSC   Ensembl
• Gene name: myosin IF
• Alternate names: unconventional myosin-If, myosin-ID, myosin-Ie,
• Gene location: 19p13.2 (8577441: 8520777)     Exons: 29     NC_000019.10
• Gene summary(Entrez): Myosins are molecular motors that use the energy from ATP hydrolysis to generate force on actin filaments. The protein encoded by this gene is an unconventional myosin that may be involved in the intracellular movement of membrane-enclosed compartments. T
• OMIM: 614287

Protein Summary

• Protein general information: O00160  
  • Name: Unconventional myosin If (Myosin Ie)
  • Length: 1098  
  • Mass: 124844
• Sequence:

  MGSKERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDREIDLYQ
  GAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGEKVQHVKDIILQSNPL
  LEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQRQNL
  GLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQLVAGILHLGNISFCEDGNYARVESV
  DLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTRDALAKGLYARLFDFLVEAINRAMQK
  PQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIQYFNNKVVCDLIEN
  KLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLF
  SDLIELMQTSEQAFLRMLFPEKLDGDKKGRPSTAGSKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENR
  VKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVF
  VKNPESLFLLEEVRERKFDGFARTIQKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERP
  ELRQFLGKRERVDFADSVTKYDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGQVCEVLKKKVDIQALRGVSLS
  TRQDDFFILQEDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGD
  LAVLKVGGRTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG
  GTHRPPRGPPSTSLGASRRPRARPPSEHNTEFLNVPDQGMAGMQRKRSVGQRPVPGVGRPKPQPRTHGPRCRALY
  QYVGQDVDELSFNVNEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI

• Structural information:
  • Protein Domains: (17..69-)
    (/note="Myosin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00782-)
    (693..72-)
    (/note="IQ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116-)
    (728..91-)
    (/note="TH1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01093-)
    (-)
  • Interpro: IPR035507  IPR000048  IPR036961  IPR001609  IPR010926   IPR036072  IPR027417  IPR036028  IPR001452  
  • Prosite: PS50096 PS51456 PS50002 PS51757
  • CDD: cd01378 cd11827
  • STRING: ENSP00000344871
• Other Databases: GeneCards:  MYO1F  Malacards:  MYO1F

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000146	microfilament motor activity	IBA	molecular function
GO:0007015	actin filament organization	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0030050	vesicle transport along actin filament	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0030898	actin-dependent ATPase activity	IBA	molecular function
GO:0031982	vesicle	IBA	cellular component
GO:0098858	actin-based cell projection	IBA	cellular component
GO:0003774	motor activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016461	unconventional myosin complex	NAS	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005524	ATP binding	NAS	molecular function
GO:0003779	actin binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray