• Gene id: 4519

Gene Summary

• Gene Symbol: CYTB   Gene   UCSC   Ensembl
• Aliases: MTCYB
• Gene name: mitochondrially encoded cytochrome b
• OMIM: 0

Protein Summary

• Protein general information: P00156  
  • Name: Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b c1 complex subunit 3) (Ubiquinol cytochrome c reductase complex cytochrome b subunit)
  • Length: 380  
  • Mass: 42,718
• Sequence:

  MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHITRDVNY
  GWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLL
  SAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYT
  IKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
  LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENK
  MLKWA

• Structural information:
  • Interpro: IPR005798  IPR036150  IPR005797  IPR027387  IPR030689   IPR016174  
  • Prosite: PS51003 PS51002
  • CDD: cd00290 cd00284
  • PDB: 5XTE 5XTH 5XTI
  • PDBsum: 5XTE 5XTH 5XTI
  • STRING: ENSP00000354554
• Other Databases: GeneCards:  CYTB  Malacards:  CYTB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005750	mitochondrial respiratory chain complex III	NAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	NAS	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0008121	ubiquinol-cytochrome-c reductase activity	NAS	molecular function
GO:0009055	electron carrier activity	IEA	molecular function
GO:0009408	response to heat	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0033590	response to cobalamin	IEA	biological process
GO:0033762	response to glucagon	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042538	hyperosmotic salinity response	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0046689	response to mercury ion	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051592	response to calcium ion	IEA	biological process
GO:0055093	response to hyperoxia	IEA	biological process
GO:1902600	hydrogen ion transmembrane transport	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005750	mitochondrial respiratory chain complex III	NAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IEA	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	NAS	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0008121	ubiquinol-cytochrome-c reductase activity	IEA	molecular function
GO:0008121	ubiquinol-cytochrome-c reductase activity	NAS	molecular function
GO:0009055	electron carrier activity	IEA	molecular function
GO:0009055	electron carrier activity	IEA	molecular function
GO:0009408	response to heat	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0015992	proton transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0022904	respiratory electron transport chain	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0033590	response to cobalamin	IEA	biological process
GO:0033762	response to glucagon	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042538	hyperosmotic salinity response	IEA	biological process
GO:0043234	protein complex	IEA	cellular component
GO:0045275	respiratory chain complex III	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0046689	response to mercury ion	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051592	response to calcium ion	IEA	biological process
GO:0055093	response to hyperoxia	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070469	respiratory chain	IEA	cellular component
GO:1902600	hydrogen ion transmembrane transport	IEA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005750	mitochondrial respiratory chain complex III	NAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	NAS	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0008121	ubiquinol-cytochrome-c reductase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04260	Cardiac muscle contraction
hsa04714	Thermogenesis
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa05016	Huntington disease
hsa04932	Non-alcoholic fatty liver disease

Diseases

Associated diseases	References
Cancer	GAD: 18709563
Cancer (colorectal)	GAD: 19050702
Cancer (breast)	GAD: 18709563
Diabetes	GAD: 19758471
Obesity	GAD: 17015183
Mitochondrial diseases	KEGG: H00473
Kearns-Sayre Syndrome	KEGG: H01355
Leber hereditary optic atrophy	KEGG: H00068
Alzheimer's disease	GAD: 19758471
Schizophrenia	GAD: 19290059
Pregnancy loss	GAD: 19297417
Asthenozoospermia	MIK: 18481423
Male factor infertility	MIK: 18481423
Asthenozoospermia	MIK: 18481423
Asthenoozoospermia	MIK: 32167074
Asthenospermia	MIK: 18481423
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18481423	Asthenospermia	MTATP6 (G8887A)		100 (80 semen samples of asthenospermia, 20 of normal sperm motility)	Male infertility	MTCYB MTATP6
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
32167074	Asthenoozoospermia			12 (6controls, 6 cases)	Male infertility	Microarray