• Gene id: 4515

Gene Summary

• Gene Symbol: MTCP1   Gene   UCSC   Ensembl
• Aliases: P13MTCP1, TCL1C, p8MTCP1
• Gene name: mature T cell proliferation 1
• Alternate names: protein p13 MTCP-1, MTCP-1 type B1, TCL1 family AKT coactivator C, mature T-cell proliferation 1 isoform p13, mature T-cell proliferation-1 type B1,
• Gene location: Xq28 (155071135: 155064033)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two dif
• OMIM: 300116

Protein Summary

• Protein general information: P56278  
  • Name: Protein p13 MTCP 1 (p13MTCP1) (Mature T cell proliferation 1 type B1) (MTCP 1 type B1)
  • Length: 107  
  • Mass: 12600
  • Tissue specificity: Not found at a significant level in any tissue.
• Sequence:

  MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEE
  RYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

• Structural information:
  • Interpro: IPR004832  IPR036672  
  • PDB: 1A1X 1QTT 1QTU
  • PDBsum: 1A1X 1QTT 1QTU
  • STRING: ENSP00000358488
• Other Databases: GeneCards:  MTCP1  Malacards:  MTCP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IBA	biological process
GO:0043539	protein serine/threonine kinase activator activity	IEA	molecular function
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881