• Gene id: 4514

Gene Summary

• Gene Symbol: COX3   Gene   UCSC   Ensembl
• Aliases: COIII, MTCO3
• Gene name: mitochondrially encoded cytochrome c oxidase III
• Alternate names: cytochrome c oxidase III, cytochrome c oxidase subunit III,
• OMIM: 0

Protein Summary

• Protein general information: P00414  
  • Name: Cytochrome c oxidase subunit 3 (Cytochrome c oxidase polypeptide III)
  • Length: 261  
  • Mass: 29,951
• Sequence:

  MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPV
  QKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHS
  LMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMF
  HFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS

• Structural information:
  • Interpro: IPR024791  IPR033945  IPR000298  IPR035973  IPR013833  
  • Prosite: PS50253
  • CDD: cd01665
  • STRING: ENSP00000354982
• Other Databases: GeneCards:  COX3  Malacards:  COX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004129	cytochrome-c oxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0008535	respiratory chain complex IV assembly	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019646	aerobic electron transport chain	IEA	biological process
GO:0045277	respiratory chain complex IV	IDA	cellular component
GO:1902600	hydrogen ion transmembrane transport	IEA	biological process
GO:0004129	cytochrome-c oxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0008535	respiratory chain complex IV assembly	IMP	biological process
GO:0015002	heme-copper terminal oxidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019646	aerobic electron transport chain	IEA	biological process
GO:0022904	respiratory electron transport chain	IEA	biological process
GO:0045277	respiratory chain complex IV	IDA	cellular component
GO:1902600	hydrogen ion transmembrane transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0008535	respiratory chain complex IV assembly	IMP	biological process
GO:0045277	respiratory chain complex IV	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04260	Cardiac muscle contraction
hsa04714	Thermogenesis
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa05016	Huntington disease
hsa04932	Non-alcoholic fatty liver disease

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 19050702
Cancer (gastric)	GAD: 19527772
Cancer (glaucoma)	GAD: 16604388
Cancer	GAD: 19527772
Cancer (prostate)	GAD: 21129724
Cancer (ovarian)	GAD: 18662401
Diabetes	GAD: 19758471
Kearns-Sayre Syndrome	KEGG: H01355
Leber hereditary optic atrophy	KEGG: H00068
Alzheimer's disease	GAD: 19758471
Pregnancy loss	GAD: 19297417
Premature ovarian failure (POF)	GAD: 20680310
Asthenozoospermia	MIK: 24550096
Asthenozoospermia	MIK: 24550096

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24550096	Asthenozoospermia	m.9588G>A	Tunisia n	214 (31 asthenozoospermic infertile men, 33 normozoospermic infertile men, 150 fertile men)	Male infertility