• Gene id: 4513

Gene Summary

• Gene Symbol: COX2   Gene   UCSC   Ensembl
• Aliases: COII, MTCO2
• Gene name: mitochondrially encoded cytochrome c oxidase II
• OMIM: 0

Protein Summary

• Protein general information: P00403  
  • Name: Cytochrome c oxidase subunit 2 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II)
  • Length: 227  
  • Mass: 25565
• Sequence:

  MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVL
  IALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPI
  RMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVF
  TL

• Structural information:
  • Interpro: IPR002429  IPR034210  IPR001505  IPR008972  IPR014222   IPR011759  IPR036257  
  • Prosite: PS00078 PS50857 PS50999
  • CDD: cd13912
  • PDB: 3VRJ 5Z62
  • PDBsum: 3VRJ 5Z62
  • STRING: ENSP00000354876
• Other Databases: GeneCards:  COX2  Malacards:  COX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042773	ATP synthesis coupled electron transport	IBA	biological process
GO:0004129	cytochrome-c oxidase activity	IBA	contributes to
GO:0045277	respiratory chain complex IV	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004129	cytochrome-c oxidase activity	IMP	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005507	copper ion binding	IEA	molecular function
GO:0022900	electron transport chain	IEA	biological process
GO:0004129	cytochrome-c oxidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0070469	respirasome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001171	positive regulation of ATP biosynthetic process	IEA	biological process
GO:0010940	positive regulation of necrotic cell death	IEA	biological process
GO:0010729	positive regulation of hydrogen peroxide biosynthetic process	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0009409	response to cold	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0004129	cytochrome-c oxidase activity	NAS	molecular function
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Cytochrome c oxidase	KEGG:H01368
Cytochrome c oxidase	KEGG:H01368
Huntington's disease	PMID:20660112
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)