• Gene id: 4504

Gene Summary

• Gene Symbol: MT3   Gene   UCSC   Ensembl
• Aliases: GIF, GIFB, GRIF, ZnMT3
• Gene name: metallothionein 3
• Alternate names: metallothionein-3, growth inhibitory factor, metallothionein 3 (growth inhibitory factor (neurotrophic)), metallothionein-III,
• Gene location: 16q13 (56589527: 56591084)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. This gene family member displays tissue-specific
• OMIM: 609142

Protein Summary

• Protein general information: P25713  
  • Name: Metallothionein 3 (MT 3) (GIFB) (GIF) (Growth inhibitory factor) (Metallothionein III) (MT III)
  • Length: 68  
  • Mass: 6927
  • Tissue specificity: Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain.
• Sequence:

  MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

• Structural information:
  • Interpro: IPR003019  IPR017854  IPR023587  IPR000006  IPR018064  
  • Prosite: PS00203
  • PDB: 2F5H 2FJ4 2FJ5
  • PDBsum: 2F5H 2FJ4 2FJ5
  • STRING: ENSP00000200691
• Other Databases: GeneCards:  MT3  Malacards:  MT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071276	cellular response to cadmium ion	IBA	biological process
GO:0071280	cellular response to copper ion	IBA	biological process
GO:0071294	cellular response to zinc ion	IBA	biological process
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0010273	detoxification of copper ion	IBA	biological process
GO:0046872	metal ion binding	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0010038	response to metal ion	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097450	astrocyte end-foot	IEA	cellular component
GO:0097449	astrocyte projection	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0097214	positive regulation of lysosomal membrane permeability	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0033210	leptin-mediated signaling pathway	IEA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0010507	negative regulation of autophagy	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006875	cellular metal ion homeostasis	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0006707	cholesterol catabolic process	IEA	biological process
GO:0006112	energy reserve metabolic process	IEA	biological process
GO:2000296	negative regulation of hydrogen peroxide catabolic process	IEA	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005507	copper ion binding	IEA	molecular function
GO:2000376	positive regulation of oxygen metabolic process	IEA	biological process
GO:0060547	negative regulation of necrotic cell death	IEA	biological process
GO:0060049	regulation of protein glycosylation	IEA	biological process
GO:0055073	cadmium ion homeostasis	IEA	biological process
GO:0050768	negative regulation of neurogenesis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0044242	cellular lipid catabolic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0032095	regulation of response to food	IEA	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0010977	negative regulation of neuron projection development	TAS	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0055073	cadmium ion homeostasis	IDA	biological process
GO:0051354	negative regulation of oxidoreductase activity	IDA	biological process
GO:0046870	cadmium ion binding	IDA	molecular function
GO:0046870	cadmium ion binding	IDA	molecular function
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0036091	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IDA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0030517	negative regulation of axon extension	IDA	biological process
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0019430	removal of superoxide radicals	IDA	biological process
GO:0010940	positive regulation of necrotic cell death	IDA	biological process
GO:0010940	positive regulation of necrotic cell death	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:2000117	negative regulation of cysteine-type endopeptidase activity	IDA	biological process
GO:0071732	cellular response to nitric oxide	IDA	biological process
GO:0071276	cellular response to cadmium ion	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0055069	zinc ion homeostasis	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0016234	inclusion body	IDA	cellular component
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0060547	negative regulation of necrotic cell death	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0046870	cadmium ion binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0030517	negative regulation of axon extension	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0001666	response to hypoxia	IDA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:0032148	activation of protein kinase B activity	IDA	biological process
GO:0008144	drug binding	IDA	molecular function
GO:2000376	positive regulation of oxygen metabolic process	ISS	biological process
GO:0060547	negative regulation of necrotic cell death	ISS	biological process
GO:0060049	regulation of protein glycosylation	ISS	biological process
GO:0044242	cellular lipid catabolic process	ISS	biological process
GO:0034599	cellular response to oxidative stress	IEP	biological process
GO:0032095	regulation of response to food	ISS	biological process
GO:0030308	negative regulation of cell growth	IMP	biological process
GO:0030308	negative regulation of cell growth	TAS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0006882	cellular zinc ion homeostasis	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0033210	leptin-mediated signaling pathway	ISS	biological process
GO:0016209	antioxidant activity	NAS	molecular function
GO:0010942	positive regulation of cell death	ISS	biological process
GO:0010507	negative regulation of autophagy	ISS	biological process
GO:0006875	cellular metal ion homeostasis	NAS	biological process
GO:0006112	energy reserve metabolic process	ISS	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0016570	histone modification	IMP	biological process
GO:0014002	astrocyte development	ISS	biological process
GO:0005507	copper ion binding	TAS	molecular function
GO:0097214	positive regulation of lysosomal membrane permeability	ISS	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0006875	cellular metal ion homeostasis	TAS	biological process
GO:0006829	zinc ion transport	ISS	biological process
GO:0006707	cholesterol catabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Alzheimer's disease	PMID:1464312
Alzheimer's disease	PMID:19619132
Psychotic disorder	PMID:18992145
Amyotrophic lateral sclerosis	PMID:12417341
Multiple system atrophy	PMID:20039155
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881