• Gene id: 4502

Gene Summary

• Gene Symbol: MT2A   Gene   UCSC   Ensembl
• Aliases: MT-2, MT-II, MT2
• Gene name: metallothionein 2A
• Alternate names: metallothionein-2, metallothionein-II,
• Gene location: 16q13 (56608583: 56609496)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heav
• OMIM: 156360

Protein Summary

• Protein general information: P02795  
  • Name: Metallothionein 2 (MT 2) (Metallothionein 2A) (Metallothionein II) (MT II)
  • Length: 61  
  • Mass: 6042
• Sequence:

  MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA

• Structural information:
  • Interpro: IPR003019  IPR017854  IPR023587  IPR000006  IPR018064  
  • Prosite: PS00203
  • PDB: 1MHU 2MHU
  • PDBsum: 1MHU 2MHU
  • DIP: 35232
  • STRING: ENSP00000245185
• Other Databases: GeneCards:  MT2A  Malacards:  MT2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0010273	detoxification of copper ion	IBA	biological process
GO:0046872	metal ion binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0071276	cellular response to cadmium ion	IBA	biological process
GO:0071280	cellular response to copper ion	IBA	biological process
GO:0071294	cellular response to zinc ion	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006878	cellular copper ion homeostasis	TAS	biological process
GO:0010038	response to metal ion	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0035690	cellular response to drug	IDA	biological process
GO:0071294	cellular response to zinc ion	IEP	biological process
GO:0036018	cellular response to erythropoietin	IEP	biological process
GO:0008270	zinc ion binding	ISS	molecular function
GO:0045926	negative regulation of growth	ISS	biological process
GO:0036016	cellular response to interleukin-3	IEP	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Carotid stenosis	PMID:17622311
Psychotic disorder	PMID:18992145
type 2 diabetes mellitus	PMID:18349110
type 2 diabetes mellitus	PMID:16518702
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)