• Gene id: 4501

Gene Summary

• Gene Symbol: MT1X   Gene   UCSC   Ensembl
• Aliases: MT-1l, MT1
• Gene name: metallothionein 1X
• Alternate names: metallothionein-1X, MT-1X, MT-IX, metallothionein-IX, testicular tissue protein Li 124,
• Gene location: 16q13 (56682469: 56684195)     Exons: 3     NC_000016.10
• OMIM: 156359

Protein Summary

• Protein general information: P80297  
  • Name: Metallothionein 1X (MT 1X) (Metallothionein IX) (MT IX)
  • Length: 61  
  • Mass: 6068
• Sequence:

  MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA

• Structural information:
  • Interpro: IPR003019  IPR017854  IPR023587  IPR000006  IPR018064  
  • Prosite: PS00203
  • STRING: ENSP00000377995
• Other Databases: GeneCards:  MT1X  Malacards:  MT1X

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0071276	cellular response to cadmium ion	IBA	biological process
GO:0071280	cellular response to copper ion	IBA	biological process
GO:0071294	cellular response to zinc ion	IBA	biological process
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0010273	detoxification of copper ion	IBA	biological process
GO:0046872	metal ion binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	TAS	molecular function
GO:0010038	response to metal ion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071294	cellular response to zinc ion	IEP	biological process
GO:0071276	cellular response to cadmium ion	IEP	biological process
GO:0008270	zinc ion binding	ISS	molecular function
GO:0036018	cellular response to erythropoietin	IEP	biological process
GO:0045926	negative regulation of growth	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)