• Gene id: 4495

Gene Summary

• Gene Symbol: MT1G   Gene   UCSC   Ensembl
• Aliases: MT1, MT1K
• Gene name: metallothionein 1G
• Alternate names: metallothionein-1G, MT-1G, MT-1K, MT-IG, metallothionein-1K, metallothionein-IG,
• Gene location: 16q13 (56668064: 56666729)     Exons: 3     NC_000016.10
• OMIM: 156353

Protein Summary

• Protein general information: P13640  
  • Name: Metallothionein 1G (MT 1G) (Metallothionein 1K) (MT 1K) (Metallothionein IG) (MT IG)
  • Length: 62  
  • Mass: 6141
• Sequence:

  MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA

• Structural information:
  • Interpro: IPR003019  IPR017854  IPR023587  IPR000006  IPR018064  
  • Prosite: PS00203
  • STRING: ENSP00000391397
• Other Databases: GeneCards:  MT1G  Malacards:  MT1G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0071276	cellular response to cadmium ion	IBA	biological process
GO:0071280	cellular response to copper ion	IBA	biological process
GO:0071294	cellular response to zinc ion	IBA	biological process
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0010273	detoxification of copper ion	IBA	biological process
GO:0046872	metal ion binding	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0045926	negative regulation of growth	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071294	cellular response to zinc ion	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0071294	cellular response to zinc ion	IEP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IEP	biological process
GO:0030224	monocyte differentiation	NAS	biological process
GO:0042117	monocyte activation	NAS	biological process
GO:0071294	cellular response to zinc ion	IEP	biological process
GO:0071294	cellular response to zinc ion	IEP	biological process
GO:0071294	cellular response to zinc ion	IEP	biological process
GO:0071280	cellular response to copper ion	IEP	biological process
GO:0071276	cellular response to cadmium ion	IEP	biological process
GO:0071276	cellular response to cadmium ion	IEP	biological process
GO:0071276	cellular response to cadmium ion	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881