• Gene id: 4490

Gene Summary

• Gene Symbol: MT1B   Gene   UCSC   Ensembl
• Aliases: MT-1B, MT-IB, MT1, MT1Q, MTP
• Gene name: metallothionein 1B
• Alternate names: metallothionein-1B, metallothionein 1B (functional), metallothionein 1Q, metallothionein-IB,
• Gene location: 16q13 (56651885: 56653203)     Exons: 3     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene binds heavy metals and protects against toxicity from heavy metal ions. This gene is found in a cluster of similar genes on chromosome 16. [provided by RefSeq, Jul 2016]
• OMIM: 611736

Protein Summary

• Protein general information: P07438  
  • Name: Metallothionein 1B (MT 1B) (Metallothionein IB) (MT IB)
  • Length: 61  
  • Mass: 6115
• Sequence:

  MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCCA

• Structural information:
  • Interpro: IPR003019  IPR017854  IPR023587  IPR000006  IPR018064  
  • Prosite: PS00203
  • STRING: ENSP00000334998
• Other Databases: GeneCards:  MT1B  Malacards:  MT1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0010273	detoxification of copper ion	IBA	biological process
GO:0046872	metal ion binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0071276	cellular response to cadmium ion	IBA	biological process
GO:0071280	cellular response to copper ion	IBA	biological process
GO:0071294	cellular response to zinc ion	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	ISS	molecular function
GO:0045926	negative regulation of growth	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0071294	cellular response to zinc ion	IEP	biological process
GO:0005737	cytoplasm	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881