• Gene id: 4486

Gene Summary

• Gene Symbol: MST1R   Gene   UCSC   Ensembl
• Aliases: CD136, CDw136, NPCA3, PTK8, RON, SEA
• Gene name: macrophage stimulating 1 receptor
• Alternate names: macrophage-stimulating protein receptor, MSP receptor, PTK8 protein tyrosine kinase 8, S13 avian erythroblastosis oncogene homolog, S13 erythroblastosis oncogene homolog, c-met-related tyrosine kinase, p185-Ron,
• Gene location: 3p21.31 (49903872: 49886470)     Exons: 21     NC_000003.12
• Gene summary(Entrez): This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-c
• OMIM: 612003

Protein Summary

• Protein general information: Q04912  
  • Name: Macrophage stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (CDw136) (Protein tyrosine kinase 8) (p185 Ron) (CD antigen CD136) [Cleaved into: Macrophage stimulating protein receptor alpha chain; Macrophage stimulating protein receptor beta chain]
  • Length: 1400  
  • Mass: 152241
  • Tissue specificity: Expressed in colon, skin, lung and bone marrow. {ECO
• Sequence:

  MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIR
  NRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEP
  QGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADA
  SGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
  RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLD
  TLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTA
  LYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGP
  GCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
  LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVTNMPPGKHFRVDGTSV
  LRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVNGTECLLARVSEGQLLCATPPGATVASVPLS
  LQVGGAQVPGSWTFQYREDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCR
  LPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
  GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLGILLPLLLLVAALATA
  LVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCVP
  LLRKESIQLRDLDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQV
  EAFLREGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
  EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQTYRFTTKSDVWSFGV
  LLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAVRPTFRVLVGEVEQIVSALLG
  DHYVQLPATYMNLGPSTSHEMNVRPEQPQFSPMPGNVRRPRPLSEPPRPT

• Structural information:
  • Protein Domains: (31..52-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (569..67-)
    (/note="IPT/TIG-1)
    (684..76-)
    (/note="IPT/TIG-2)
    (770..86-)
    (/note="IPT/TIG-3)
    (1082..134-)
    (/note="Protein-kinase)
    (/evidence="ECO:00-)
  • Interpro: IPR013783  IPR014756  IPR002909  IPR011009  IPR000719   IPR017441  IPR016201  IPR039413  IPR001627  IPR036352  IPR001245  IPR008266  IPR020635  IPR016244  IPR015943  
  • Prosite: PS00107 PS50011 PS00109 PS51004
  • CDD: cd11279
  • PDB: 3PLS 4FWW 4QT8
  • PDBsum: 3PLS 4FWW 4QT8
  • DIP: 6029
  • STRING: ENSP00000296474
• Other Databases: GeneCards:  MST1R  Malacards:  MST1R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0009925	basal plasma membrane	IBA	cellular component
GO:0051897	positive regulation of protein kinase B signaling	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005011	macrophage colony-stimulating factor receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006952	defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007338	single fertilization	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048012	hepatocyte growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0001725	stress fiber	IEA	cellular component
GO:0009615	response to virus	IEA	biological process
GO:0005773	vacuole	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0038145	macrophage colony-stimulating factor signaling pathway	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0009986	cell surface	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq