• Gene id: 4485

Gene Summary

• Gene Symbol: MST1   Gene   UCSC   Ensembl
• Aliases: D3F15S2, DNF15S2, HGFL, MSP, NF15S2
• Gene name: macrophage stimulating 1
• Alternate names: hepatocyte growth factor-like protein, hepatocyte growth factor-like protein homolog, macrophage stimulating 1 (hepatocyte growth factor-like), macrophage-stimulating protein,
• Gene location: 3p21.31 (49689522: 49683946)     Exons: 18     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The
• OMIM: 142408

Protein Summary

• Protein general information: P26927  
  • Name: Hepatocyte growth factor like protein (Macrophage stimulatory protein) (Macrophage stimulating protein) (MSP) [Cleaved into: Hepatocyte growth factor like protein alpha chain; Hepatocyte growth factor like protein beta chain]
  • Length: 711  
  • Mass: 80320
• Sequence:

  MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSS
  HGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRN
  GLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPF
  EPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTA
  GVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRRCTDDVRPQDCYHGAG
  EQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCAD
  DQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFS
  SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT
  KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVL
  EGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG

• Structural information:
  • Protein Domains: (21..10-)
    (/note="PAN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00315-)
    (110..18-)
    (/note="Kringle-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00121-)
    (191..26-)
    (/note="Kringle-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00121"-)
  • Interpro: IPR024174  IPR000001  IPR013806  IPR018056  IPR038178   IPR003609  IPR009003  IPR001314  IPR001254  
  • Prosite: PS00021 PS50070 PS50948 PS50240
  • CDD: cd00108 cd00190
  • PDB: 2ASU 4QT8
  • PDBsum: 2ASU 4QT8
  • DIP: 6028
  • STRING: ENSP00000414287
• Other Databases: GeneCards:  MST1  Malacards:  MST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035978	histone H2A-S139 phosphorylation	IDA	biological process
GO:0033601	positive regulation of mammary gland epithelial cell proliferation	IBA	biological process
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0010758	regulation of macrophage chemotaxis	IBA	biological process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular function
GO:0045721	negative regulation of gluconeogenesis	IDA	biological process
GO:2000479	regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0048012	hepatocyte growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Polycystic ovary syndrome (PCOS)	INFBASE: 19542541
Inflammatory bowel disease	KEGG:H01227
Ulcerative colitis	KEGG:H01466
Inflammatory bowel disease	KEGG:H01227
Ulcerative colitis	KEGG:H01466
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray