• Gene id: 4482

Gene Summary

• Gene Symbol: MSRA   Gene   UCSC   Ensembl
• Aliases: PMSR
• Gene name: methionine sulfoxide reductase A
• Alternate names: mitochondrial peptide methionine sulfoxide reductase, cytosolic methionine-S-sulfoxide reductase, peptide Met(O) reductase, peptide met (O) reductase, peptide-methionine (S)-S-oxide reductase,
• Gene location: 8p23.1 (10054223: 10428890)     Exons: 12     NC_000008.11
• Gene summary(Entrez): This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein func
• OMIM: 601250

Protein Summary

• Protein general information: Q9UJ68  
  • Name: Mitochondrial peptide methionine sulfoxide reductase (EC 1.8.4.11) (Peptide methionine (S) S oxide reductase) (Peptide Met(O) reductase) (Protein methionine S oxide reductase) (PMSR)
  • Length: 235  
  • Mass: 26132
  • Tissue specificity: Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
• Sequence:

  MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCF
  WGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQG
  NDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGT
  GVSCPVGIKK

• Structural information:
  • Interpro: IPR002569  IPR036509  
  • STRING: ENSP00000313921
• Other Databases: GeneCards:  MSRA  Malacards:  MSRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0008113	peptide-methionine (S)-S-oxide reductase activity	IBA	molecular function
GO:0036456	L-methionine-(S)-S-oxide reductase activity	IBA	molecular function
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0008113	peptide-methionine (S)-S-oxide reductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008113	peptide-methionine (S)-S-oxide reductase activity	TAS	molecular function
GO:0006555	methionine metabolic process	TAS	biological process
GO:0006979	response to oxidative stress	TAS	biological process
GO:0006464	cellular protein modification process	TAS	biological process
GO:0008113	peptide-methionine (S)-S-oxide reductase activity	IEA	molecular function
GO:0008113	peptide-methionine (S)-S-oxide reductase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0030091	protein repair	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008113	peptide-methionine (S)-S-oxide reductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq