• Gene id: 4478

Gene Summary

• Gene Symbol: MSN   Gene   UCSC   Ensembl
• Aliases: HEL70, IMD50
• Gene name: moesin
• Alternate names: moesin, epididymis luminal protein 70, membrane-organizing extension spike protein,
• Gene location: Xq12 (65588381: 65741930)     Exons: 18     NC_000023.11
• Gene summary(Entrez): Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopo
• OMIM: 309845

SNPs

rs13265504

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.3674977G>A
NC_000008.11   g.3674977G>C
NC_000008.11   g.3674977G>T
NC_000008.10   g.3532499G>A
NC_000008.10   g.3532499G>C
NC_000008.10   g.3532499G>T|SEQ=[G/A/C/T]|GENE=CSMD1

Protein Summary

• Protein general information: P26038  
  • Name: Moesin (Membrane organizing extension spike protein)
  • Length: 577  
  • Mass: 67820
  • Tissue specificity: In all tissues and cultured cells studied.
• Sequence:

  MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESP
  LLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGD
  KLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGL
  NIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
  EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKKAQQELEEQTRRALEL
  EQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQ
  MVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKAL
  TSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM

• Structural information:
  • Protein Domains: (2..29-)
    (/note="FERM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00084"-)
  • Interpro: IPR019749  IPR011174  IPR011259  IPR041789  IPR000798   IPR014352  IPR035963  IPR019748  IPR019747  IPR000299  IPR018979  IPR018980  IPR008954  IPR011993  IPR029071  
  • Prosite: PS00660 PS00661 PS50057
  • CDD: cd14473 cd13194
  • PDB: 1E5W 1EF1 1SGH
  • PDBsum: 1E5W 1EF1 1SGH
  • DIP: 33841
  • STRING: ENSP00000353408
• Other Databases: GeneCards:  MSN  Malacards:  MSN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0071437	invadopodium	IDA	cellular component
GO:0072678	T cell migration	IDA	biological process
GO:0042098	T cell proliferation	IDA	biological process
GO:0070489	T cell aggregation	IDA	biological process
GO:0001771	immunological synapse formation	IDA	biological process
GO:2000401	regulation of lymphocyte migration	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001931	uropod	IEA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0045177	apical part of cell	IEA	cellular component
GO:0071803	positive regulation of podosome assembly	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0005902	microvillus	IDA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0045177	apical part of cell	IDA	cellular component
GO:0007159	leukocyte cell-cell adhesion	IEP	biological process
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0050900	leukocyte migration	IEP	biological process
GO:0005925	focal adhesion	IDA	colocalizes with
GO:0031528	microvillus membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0071394	cellular response to testosterone stimulus	IDA	biological process
GO:0030175	filopodium	IDA	cellular component
GO:0031143	pseudopodium	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008361	regulation of cell size	IMP	NOT|biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0031982	vesicle	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008360	regulation of cell shape	IMP	biological process
GO:1902966	positive regulation of protein localization to early endosome	IGI	biological process
GO:2000643	positive regulation of early endosome to late endosome transport	IGI	biological process
GO:1903364	positive regulation of cellular protein catabolic process	IGI	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0005737	cytoplasm	HDA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0022612	gland morphogenesis	IMP	biological process
GO:1902115	regulation of organelle assembly	IGI	biological process
GO:0008361	regulation of cell size	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045198	establishment of epithelial cell apical/basal polarity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa05205	Proteoglycans in cancer
hsa04530	Tight junction
hsa04670	Leukocyte transendothelial migration
hsa05162	Measles

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)