• Gene id: 4477

Gene Summary

• Gene Symbol: MSMB   Gene   UCSC   Ensembl
• Aliases: HPC13, IGBF, MSP, MSPB, PN44, PRPS, PSP, PSP-94, PSP57, PSP94
• Gene name: microseminoprotein beta
• Alternate names: beta-microseminoprotein, immunoglobulin binding factor, prostate secreted seminal plasma protein, prostate secretory protein of 94 amino acids, seminal plasma beta-inhibin,
• Gene location: 10q11.22 (46046268: 46033304)     Exons: 4     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as a
• OMIM: 157145

Protein Summary

• Protein general information: P08118  
  • Name: Beta microseminoprotein (Immunoglobulin binding factor) (IGBF) (PN44) (Prostate secreted seminal plasma protein) (Prostate secretory protein of 94 amino acids) (PSP 94) (PSP94) (Seminal plasma beta inhibin)
  • Length: 114  
  • Mass: 12,865
• Sequence:

  MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVST
  PVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

• Structural information:
  • Interpro: IPR008735  
  • PDB: 2IZ3 3IX0
  • PDBsum: 2IZ3 3IX0
  • STRING: ENSP00000351363
• Other Databases: GeneCards:  MSMB  Malacards:  MSMB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cancer	GAD: 20696662
Cancer (prostate)	GAD: 19366831
Oligoasthenozoospermia	MIK: 8867597
Male factor infertility	MIK: 8867597
Male infertility	MIK: 18367176
Oligoasthenozoospermia	MIK: 8867597
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
8867597	Oligo-asthenozoospermia			62 (35 normozoospermic men, 27 asthenozoospermic men, oligozoospermic)	Male infertility	PSA PAP Zn alpha 2-glycoprotein (Zn alpha 2-GP) beta-microseminoprotein (beta-MSP)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
18367176	Male infertility				Male infertility	Microarray