• Gene id: 442721

Gene Summary

• Gene Symbol: LMOD2   Gene   UCSC   Ensembl
• Aliases: C-LMOD, CLMOD
• Gene name: leiomodin 2
• Alternate names: leiomodin-2, cardiac leiomodin, leiomodin 2 (cardiac),
• Gene location: 7q31.32 (123655865: 123664289)     Exons: 3     NC_000007.14
• OMIM: 614059

Protein Summary

• Protein general information: Q6P5Q4  
  • Name: Leiomodin 2 (Cardiac leiomodin) (C LMOD) (Leiomodin)
  • Length: 547  
  • Mass: 61675
  • Tissue specificity: Specifically expressed in heart and skeletal muscles, with higher levels in heart (at protein level). Not expressed in other tissues. {ECO
• Sequence:

  MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEK
  ESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEEEEEESQEEEEEEDSDEEERTIETAKGINGT
  VNYDSVNSDNSKPKIFKSQIENINLTNGSNGRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENIT
  TQTLTRFAEALKDNTVVKTFSLANTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTE
  LRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTRNMDKQRQKRLQEQKQQEGYDGGPNL
  RTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVATPPPPPPPPPPPPPSSQRLPPPPPPPPPPLP
  EKKLITRNIAEVIKQQESAQRALQNGQKKKKGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQRSAHENL
  MEAIRGSSIKQLKRVEVPEALR

• Structural information:
  • Protein Domains: (521..54-)
    (/note="WH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00406"-)
  • Interpro: IPR030132  IPR032675  IPR004934  IPR003124  
  • Prosite: PS51082
  • PDB: 4RWT 5WFN
  • PDBsum: 4RWT 5WFN
  • STRING: ENSP00000411932
• Other Databases: GeneCards:  LMOD2  Malacards:  LMOD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005856	cytoskeleton	IBA	cellular component
GO:0006936	muscle contraction	IBA	biological process
GO:0030016	myofibril	IBA	cellular component
GO:0030239	myofibril assembly	IBA	biological process
GO:0005523	tropomyosin binding	IBA	molecular function
GO:0005865	striated muscle thin filament	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0045010	actin nucleation	IDA	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0045010	actin nucleation	IDA	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0030016	myofibril	IDA	cellular component
GO:0030017	sarcomere	IDA	cellular component
GO:0031430	M band	IDA	colocalizes with
GO:0030838	positive regulation of actin filament polymerization	IDA	biological process
GO:0031430	M band	IDA	colocalizes with
GO:0030017	sarcomere	IDA	cellular component
GO:0030017	sarcomere	IDA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0045214	sarcomere organization	IMP	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005523	tropomyosin binding	IEA	molecular function
GO:0051694	pointed-end actin filament capping	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030041	actin filament polymerization	IEA	biological process
GO:0045214	sarcomere organization	IEA	biological process
GO:0030017	sarcomere	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030016	myofibril	IEA	cellular component
GO:0031430	M band	IEA	cellular component
GO:0045010	actin nucleation	IMP	biological process
GO:0003785	actin monomer binding	IMP	molecular function
GO:0005523	tropomyosin binding	IMP	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq