• Gene id: 441478

Gene Summary

• Gene Symbol: NRARP   Gene   UCSC   Ensembl
• Gene name: NOTCH regulated ankyrin repeat protein
• Alternate names: notch-regulated ankyrin repeat-containing protein,
• Gene location: 9q34.3 (137302270: 137299630)     Exons: 1     NC_000009.12

Protein Summary

• Protein general information: Q7Z6K4  
  • Name: Notch regulated ankyrin repeat containing protein
  • Length: 114  
  • Mass: 12492
• Sequence:

  MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGA
  DIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • PDB: 6PY8
  • PDBsum: 6PY8
  • STRING: ENSP00000349041
• Other Databases: GeneCards:  NRARP  Malacards:  NRARP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045746	negative regulation of Notch signaling pathway	IBA	biological process
GO:0002043	blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IBA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IBA	biological process
GO:0001569	branching involved in blood vessel morphogenesis	IBA	biological process
GO:0007219	Notch signaling pathway	IDA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IMP	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0002043	blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IEA	biological process
GO:0022407	regulation of cell-cell adhesion	IEA	biological process
GO:0045581	negative regulation of T cell differentiation	IEA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0032525	somite rostral/caudal axis specification	IEA	biological process
GO:1902367	negative regulation of Notch signaling pathway involved in somitogenesis	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)