• Gene id: 441250

Gene Summary

• Gene Symbol: TYW1B   Gene   UCSC   Ensembl
• Aliases: LINC00069, NCRNA00069, RSAFD2
• Gene name: tRNA-yW synthesizing protein 1 homolog B
• Alternate names: S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1B, S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase, long intergenic non-protein coding RNA 69, radical S-adenosyl methionine and flavodoxin domain-containing protein 2, ra,
• Gene location: 7q11.22-q11.23 (72828199: 72574512)     Exons: 14     NC_000007.14
• Gene summary(Entrez): Wybutosine is a hypermodified guanosine found in phenylalanine tRNA. Wybutosine functions to stabilize codon-anticodon interactions during ribosome decoding and therefore supports the maintenance of the reading frame. In yeast, the homolog of this gene is
• OMIM: 606539

Protein Summary

• Protein general information: Q6NUM6  
  • Name: S adenosyl L methionine dependent tRNA 4 demethylwyosine synthase TYW1B (EC 4.1.3.44) (Radical S adenosyl methionine and flavodoxin domain containing protein 2) (tRNA wybutosine synthesizing protein 1 homolog B)
  • Length: 668  
  • Mass: 76946
• Sequence:

  MDPSADTWDLSSPLISLWINRFYIYLGFAVSISLWICVQIVIEMQGFATVLAEAVTSLDLPVAIINLKEYDPDDH
  LIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRDAVFGLGNSAYASHFNKVGKNVD
  KWLWMLGVHRVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEER
  EEGSQEQDELHHRDTKEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGR
  NEDGERRAMITPALREALTKQVDAPRERSLLQTHILWNESHRCMETTPSLACANKCVFCWWHHNNPVGTEWLWKM
  DQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNA
  QFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYRLMLVKAWNVDELQAYA
  QLVSLGNPDFIEVKGVTYCRESSASSLTMAHVPWHEEVVQFVRELVDLIPEYEIACEHEHSNCLLIAHRKFKIGG
  EWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGANERSFDPKDTRHQRKNKSKAISGC

• Structural information:
  • Protein Domains: (37..19-)
    (/note="Flavodoxin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00088"-)
  • Interpro: IPR013785  IPR001094  IPR008254  IPR029039  IPR007197   IPR013917  
  • Prosite: PS50902
  • STRING: ENSP00000482502
• Other Databases: GeneCards:  TYW1B  Malacards:  TYW1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031591	wybutosine biosynthetic process	IBA	biological process
GO:0010181	FMN binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0102521	tRNA-4-demethylwyosine synthase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq