• Gene id: 441168

Gene Summary

• Gene Symbol: CALHM6   Gene   UCSC   Ensembl
• Aliases: C6orf187, FAM26F, INAM, dJ93H18.5
• Gene name: calcium homeostasis modulator family member 6
• Alternate names: calcium homeostasis modulator protein 6, IFN regulatory factor 3-dependent NK-activating molecule, family with sequence similarity 26 member F, protein FAM26F,
• Gene location: 6q22.1 (116461374: 116463781)     Exons: 3     NC_000006.12
• OMIM: 617305

Protein Summary

• Protein general information: Q5R3K3  
  • Name: Calcium homeostasis modulator protein 6 (Protein FAM26F)
  • Length: 315  
  • Mass: 34458
• Sequence:

  MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPALALFLLGYVLSARTW
  RLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLGGAFYECAATGSAAFAQRLCLGRNRSCAAEL
  PLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIFTSVTRCLSPVSFLQLKFWKIYLEQEQQILKSKA
  TEHATELAKENIKCFFEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYVNRKEKTHSIRSTEGDTVIPV
  LGFVDSSGINSTPEL

• Structural information:
  • Interpro: IPR029569  IPR029573  
  • STRING: ENSP00000357594
• Other Databases: GeneCards:  CALHM6  Malacards:  CALHM6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005261	cation channel activity	IBA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)