• Gene id: 441161

Gene Summary

• Gene Symbol: OOEP   Gene   UCSC   Ensembl
• Aliases: C6orf156, FLOPED, HOEP19, KHDC2
• Gene name: oocyte expressed protein
• Alternate names: oocyte-expressed protein homolog, KH homology domain containing 2, KH homology domain-containing protein 2, oocyte and embryo protein 19, oocyte expressed protein homolog (dog), oocyte- and embryo-specific protein 19,
• Gene location: 6q13 (73369791: 73368554)     Exons: 3     NC_000006.12
• OMIM: 611689

Protein Summary

• Protein general information: A6NGQ2  
  • Name: Oocyte expressed protein homolog (KH homology domain containing protein 2) (Oocyte and embryo specific protein 19) (hOEP19)
  • Length: 149  
  • Mass: 17170
• Sequence:

  MVDDAGAAESQRGKQTPAHSLEQLRRLPLPPPQIRIRPWWFPVQELRDPLVFYLEAWLADELFGPDRAIIPEMEW
  TSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQDPVA

• Structural information:
  • Protein Domains: (49..11-)
    (/note="K-)
    (-)
  • Interpro: IPR036612  IPR031952  IPR040068  
  • CDD: cd12795
  • STRING: ENSP00000359384
• Other Databases: GeneCards:  OOEP  Malacards:  OOEP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032991	protein-containing complex	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0009880	embryonic pattern specification	IBA	biological process
GO:0035088	establishment or maintenance of apical/basal cell polarity	IBA	biological process
GO:0045179	apical cortex	IBA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq