• Gene id: 441061

Gene Summary

• Gene Symbol: MARCHF11   Gene   UCSC   Ensembl
• Aliases: MARCH-XI, MARCH11, RNF226
• Gene name: membrane associated ring-CH-type finger 11
• Alternate names: E3 ubiquitin-protein ligase MARCHF11, E3 ubiquitin-protein ligase MARCH11, RING-type E3 ubiquitin transferase MARCH11, RING-type E3 ubiquitin transferase MARCHF11, membrane associated ring finger 11, membrane-associated RING finger protein 11, membrane-associat,
• Gene location: 5p15.1 (16179790: 16067138)     Exons: 3     NC_000005.10
• Gene summary(Entrez): MARCH11 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). These enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their intracellular transport. March11 appears to have a
• OMIM: 613338

Protein Summary

• Protein general information: A6NNE9  
  • Name: E3 ubiquitin protein ligase MARCHF11 (EC 2.3.2.27) (Membrane associated RING finger protein 11) (Membrane associated RING CH protein XI) (MARCH XI) (RING type E3 ubiquitin transferase MARCHF11)
  • Length: 402  
  • Mass: 43878
• Sequence:

  MSFEGGHGGSRCRGAESGDAEPPPQPPPPPPPTPPPGEPAPVPAAPRYLPPLPASPETPERAAGPSEPLGEVAPR
  CRGADELPPPPLPLQPAGQEVAAAGDSGEGPRRLPEAAAAKGGPGESEAGAGGERERRGAGDQPETRSVCSSRSS
  SSGGGDQRAGHQHQHHQPICKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVIAIK
  MKQPCQWQSISITLVEKVQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVH
  EGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLTALRNRNLVHPTQLTSPRFQCGYVLLH
  LFNRMRPHEDLSEDNSSGEVVMRVTSV

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • STRING: ENSP00000333181
• Other Databases: GeneCards:  MARCHF11  Malacards:  MARCHF11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 23869807
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269
Non obstructive azoospermia	MIK: 24012201

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)