• Gene id: 440738

Gene Summary

• Gene Symbol: MAP1LC3C   Gene   UCSC   Ensembl
• Aliases: ATG8J, LC3C
• Gene name: microtubule associated protein 1 light chain 3 gamma
• Alternate names: microtubule-associated proteins 1A/1B light chain 3C, LC3-like protein 2, MAP1 light chain 3-like protein 2, MAP1 light chain 3-like protein 3, MAP1A/MAP1B LC3 C, MAP1A/MAP1B light chain 3 C, autophagy-related protein LC3 C, autophagy-related ubiquitin-like modi,
• Gene location: 1q43 (242001392: 241995193)     Exons: 5     NC_000001.11
• Gene summary(Entrez): Autophagy is a highly regulated bulk degradation process that plays an important role in cellular maintenance and development. MAP1LC3C is an ortholog of the yeast autophagosome protein Atg8 (He et al., 2003 [PubMed 12740394]).[supplied by OMIM, Nov 2010]
• OMIM: 612646

Protein Summary

• Protein general information: Q9BXW4  
  • Name: Microtubule associated proteins 1A/1B light chain 3C (Autophagy related protein LC3 C) (Autophagy related ubiquitin like modifier LC3 C) (MAP1 light chain 3 like protein 3) (MAP1A/MAP1B light chain 3 C) (MAP1A/MAP1B LC3 C) (Microtubule associated protein
  • Length: 147  
  • Mass: 16852
  • Tissue specificity: Most abundant in placenta, lung and ovary. {ECO
• Sequence:

  MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRS
  RMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLEDRPCNPL

• Structural information:
  • Interpro: IPR004241  IPR027731  IPR029071  
  • PDB: 2NCN 3VVW 3WAM 3WAP 5DPW
  • PDBsum: 2NCN 3VVW 3WAM 3WAP 5DPW
  • DIP: 57020
  • STRING: ENSP00000349785
• Other Databases: GeneCards:  MAP1LC3C  Malacards:  MAP1LC3C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032527	protein exit from endoplasmic reticulum	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0008017	microtubule binding	IBA	molecular function
GO:0006995	cellular response to nitrogen starvation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0097352	autophagosome maturation	IBA	biological process
GO:0016236	macroautophagy	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0000421	autophagosome membrane	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035973	aggrephagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000421	autophagosome membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0097352	autophagosome maturation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0097352	autophagosome maturation	IDA	biological process
GO:0009267	cellular response to starvation	IDA	biological process
GO:0016236	macroautophagy	IDA	biological process
GO:0031090	organelle membrane	ISS	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005776	autophagosome	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04216	Ferroptosis

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R