• Gene id: 440574

Gene Summary

• Gene Symbol: MICOS10   Gene   UCSC   Ensembl
• Aliases: C1orf151, MINOS1, MIO10, Mic10
• Gene name: mitochondrial contact site and cristae organizing system subunit 10
• Alternate names: MICOS complex subunit MIC10, RP5-1056L3.2, UPF0327 protein C1orf151, mitochondrial inner membrane organizing system 1, mitochondrial inner membrane organizing system protein 1,
• Gene location: 1p36.13 (19596976: 19629820)     Exons: 7     NC_000001.11
• OMIM: 616574

Protein Summary

• Protein general information: Q5TGZ0  
  • Name: MICOS complex subunit MIC10 (Mitochondrial inner membrane organizing system protein 1)
  • Length: 78  
  • Mass: 8808
• Sequence:

  MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKE
  QEQ

• Structural information:
  • Interpro: IPR007512  
  • STRING: ENSP00000325562
• Other Databases: GeneCards:  MICOS10  Malacards:  MICOS10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061617	MICOS complex	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0007007	inner mitochondrial membrane organization	IC	biological process
GO:0005739	mitochondrion	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0061617	MICOS complex	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0140275	MIB complex	HDA	cellular component
GO:0001401	SAM complex	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)