• Gene id: 440567

Gene Summary

• Gene Symbol: UQCRHL   Gene   UCSC   Ensembl
• Gene name: ubiquinol-cytochrome c reductase hinge protein like
• Alternate names: cytochrome b-c1 complex subunit 6-like, mitochondrial, hCG25371,
• Gene location: 1p36.21 (15807698: 15807161)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-codin
• OMIM: 0

Protein Summary

• Protein general information: A0A096LP55  
  • Name: Cytochrome b c1 complex subunit 6 like, mitochondrial
  • Length: 91  
  • Mass: 10752
• Sequence:

  MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFL
  HAKDHCVAHKLFNNLK

• Structural information:
  • Interpro: IPR003422  IPR023184  IPR036811  
  • STRING: ENSP00000485401
• Other Databases: GeneCards:  UQCRHL  Malacards:  UQCRHL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009060	aerobic respiration	IBA	biological process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0005750	mitochondrial respiratory chain complex III	IBA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IEA	biological process
GO:0008121	ubiquinol-cytochrome-c reductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070469	respirasome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)