• Gene id: 440145

Gene Summary

• Gene Symbol: MZT1   Gene   UCSC   Ensembl
• Aliases: C13orf37, MOZART1
• Gene name: mitotic spindle organizing protein 1
• Alternate names: mitotic-spindle organizing protein 1, mitotic-spindle organizing protein associated with a ring of gamma-tubulin 1,
• Gene location: 13q21.33 (72727628: 72708366)     Exons: 21     NC_000013.11
• OMIM: 613448

Protein Summary

• Protein general information: Q08AG7  
  • Name: Mitotic spindle organizing protein 1 (Mitotic spindle organizing protein associated with a ring of gamma tubulin 1)
  • Length: 82  
  • Mass: 8479
• Sequence:

  MASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALK
  AAENMTS

• Structural information:
  • Interpro: IPR022214  
  • STRING: ENSP00000367049
• Other Databases: GeneCards:  MZT1  Malacards:  MZT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IBA	cellular component
GO:0008274	gamma-tubulin ring complex	IBA	cellular component
GO:0051415	microtubule nucleation by interphase microtubule organizing center	IBA	biological process
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0005819	spindle	IBA	cellular component
GO:0031021	interphase microtubule organizing center	IBA	cellular component
GO:0008274	gamma-tubulin ring complex	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0033566	gamma-tubulin complex localization	IMP	biological process
GO:0008274	gamma-tubulin ring complex	IEA	cellular component
GO:0033566	gamma-tubulin complex localization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)