• Gene id: 440087

Gene Summary

• Gene Symbol: SMCO3   Gene   UCSC   Ensembl
• Aliases: C12orf69
• Gene name: single-pass membrane protein with coiled-coil domains 3
• Alternate names: single-pass membrane and coiled-coil domain-containing protein 3,
• Gene location: 12p12.3 (14816760: 14804649)     Exons: 3     NC_000012.12
• OMIM: 618675

Protein Summary

• Protein general information: A2RU48  
  • Name: Single pass membrane and coiled coil domain containing protein 3
  • Length: 225  
  • Mass: 24877
• Sequence:

  MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMK
  IQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVT
  VLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK

• Structural information:
  • Interpro: IPR027895  IPR040004  
  • STRING: ENSP00000381895
• Other Databases: GeneCards:  SMCO3  Malacards:  SMCO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq