• Gene id: 43849

Gene Summary

• Gene Symbol: KLK12   Gene   UCSC   Ensembl
• Aliases: KLK-L5, KLKL5
• Gene name: kallikrein related peptidase 12
• Alternate names: kallikrein-12, kallikrein-like protein 5,
• Gene location: 19q13.41 (51035647: 51028953)     Exons: 6     NC_000019.10
• Gene summary(Entrez): Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one
• OMIM: 610584

Protein Summary

• Protein general information: Q9UKR0  
  • Name: Kallikrein 12 (EC 3.4.21. ) (Kallikrein like protein 5) (KLK L5)
  • Length: 248  
  • Mass: 26734
• Sequence:

  MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEH
  SLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNH
  PRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQD
  GIPGVYTYICKYVDWIRMIMRNN

• Structural information:
  • Protein Domains: (22..24-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000250351
• Other Databases: GeneCards:  KLK12  Malacards:  KLK12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0008236	serine-type peptidase activity	IDA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0005615	extracellular space	NAS	cellular component
GO:0004252	serine-type endopeptidase activity	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq