• Gene id: 4363

Gene Summary

• Gene Symbol: ABCC1   Gene   UCSC   Ensembl
• Aliases: ABC29, ABCC, GS-X, MRP, MRP1
• Gene name: ATP binding cassette subfamily C member 1
• Alternate names: multidrug resistance-associated protein 1, ATP-binding cassette transporter variant ABCC1delta-ex13, ATP-binding cassette transporter variant ABCC1delta-ex13&14, ATP-binding cassette transporter variant ABCC1delta-ex25, ATP-binding cassette transporter va,
• Gene location: 16p13.11 (15949576: 16143073)     Exons: 34     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MD
• OMIM: 158343

Protein Summary

• Protein general information: P33527  
  • Name: Multidrug resistance associated protein 1 (ATP binding cassette sub family C member 1) (Leukotriene C(4) transporter) (LTC4 transporter)
  • Length: 1531  
  • Mass: 171,591
• Sequence:

  MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPLNKTKT
  ALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCAL
  AILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWIT
  GLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
  IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTAC
  LQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQ
  VILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFK
  DKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
  MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVA
  VVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDL
  EILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILV
  THSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
  LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFIS
  FLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHV
  DLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI
  YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
  VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAP
  WQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGE
  IIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAE
  GGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
  DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV

• Structural information:
  • Protein Domains: ABC (325-608)
    ABC (644-868)
    ABC (975-1256)
    (1293-)
  • Interpro: IPR003593  IPR011527  IPR036640  IPR003439  IPR017871   IPR005292  IPR027417  
  • Prosite: PS50929 PS00211 PS50893
  • PDB: 2CBZ 4C3Z
  • PDBsum: 2CBZ 4C3Z
  • STRING: ENSP00000382342
• Other Databases: GeneCards:  ABCC1  Malacards:  ABCC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005215	transporter activity	TAS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0006810	transport	TAS	biological process
GO:0009235	cobalamin metabolic process	TAS	biological process
GO:0015420	cobalamin-transporting ATPase activity	TAS	molecular function
GO:0015889	cobalamin transport	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0016887	ATPase activity	IDA	molecular function
GO:0035461	vitamin transmembrane transport	IEA	biological process
GO:0042493	response to drug	TAS	biological process
GO:0042626	ATPase activity, coupled to transmembrane movement of substances	TAS	molecular function
GO:0043225	ATPase-coupled anion transmembrane transporter activity	TAS	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005215	transporter activity	IEA	molecular function
GO:0005215	transporter activity	TAS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	TAS	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0006810	transport	IEA	biological process
GO:0006810	transport	IEA	biological process
GO:0006810	transport	TAS	biological process
GO:0009235	cobalamin metabolic process	TAS	biological process
GO:0015420	cobalamin-transporting ATPase activity	TAS	molecular function
GO:0015889	cobalamin transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016887	ATPase activity	IEA	molecular function
GO:0016887	ATPase activity	IDA	molecular function
GO:0035461	vitamin transmembrane transport	IEA	biological process
GO:0042493	response to drug	TAS	biological process
GO:0042626	ATPase activity, coupled to transmembrane movement of substances	IEA	molecular function
GO:0042626	ATPase activity, coupled to transmembrane movement of substances	TAS	molecular function
GO:0042626	ATPase activity, coupled to transmembrane movement of substances	TAS	molecular function
GO:0043225	ATPase-coupled anion transmembrane transporter activity	TAS	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0005215	transporter activity	TAS	molecular function
GO:0005524	ATP binding	TAS	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0006810	transport	TAS	biological process
GO:0009235	cobalamin metabolic process	TAS	biological process
GO:0015420	cobalamin-transporting ATPase activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0016887	ATPase activity	IDA	molecular function
GO:0042493	response to drug	TAS	biological process
GO:0042626	ATPase activity, coupled to transmembrane movement of substances	TAS	molecular function
GO:0042626	ATPase activity, coupled to transmembrane movement of substances	TAS	molecular function
GO:0043225	ATPase-coupled anion transmembrane transporter activity	TAS	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04071	Sphingolipid signaling pathway
hsa04977	Vitamin digestion and absorption
hsa05206	MicroRNAs in cancer
hsa01523	Antifolate resistance

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 19349540
Cancer (esophageal)	GAD: 20453000
Cancer (Hepatocellular)	GAD: 21182225
Cancer (leukemia)	GAD: 19065772
Cancer (lung)	GAD: 19107762
Cancer (myeloma)	GAD: 20532504
Cancer	GAD: 12960109
Cancer (Adenocarcinoma)	GAD: 20922799
Cancer (ovarian)	GAD: 17925548
Cancer (solid tumors)	GAD: 19924384
Apoplexy	GAD: 20198315
Atherosclerosis	GAD: 19948975
Hypertension	GAD: 19851296
Atherosclerosis	GAD: 19851296
Cardiovascular disease	GAD: 19851296
Cystic fibrosis	GAD: 16464259
Arthritis	GAD: 18381794
Psoriasis	GAD: 18256692
Asthma	GAD: 16293801
Brain ischemia	GAD: 19851296
Male factor infertility	MIK: 11466205
Chronic obstructive pulmonary disease (COPD)	GAD: 19687781
GRACILE syndrome	GAD: 12856092
Chronic renal failure	GAD: 21085059
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 11466205
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
11466205	Male infertility			50 (20 CAVD, 30 non- CAVD)	Male infertility	CFTR MDR1 and MRP
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq