• Gene id: 4361

Gene Summary

• Gene Symbol: MRE11   Gene   UCSC   Ensembl
• Aliases: ATLD, HNGS1, MRE11A, MRE11B
• Gene name: MRE11 homolog, double strand break repair nuclease
• Alternate names: double-strand break repair protein MRE11, AT-like disease, DNA recombination and repair protein, MRE11 double strand break repair nuclease A, MRE11 homolog 1, MRE11 homolog A, double strand break repair nuclease, MRE11 homolog, double strand break repair nuclea,
• Gene location: 11q21 (94512700: 94415569)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with
• OMIM: 600814

Protein Summary

• Protein general information: P49959  
  • Name: Double strand break repair protein MRE11 (EC 3.1. . ) (Double strand break repair protein MRE11A) (Meiotic recombination 11 homolog 1) (MRE11 homolog 1) (Meiotic recombination 11 homolog A) (MRE11 homolog A)
  • Length: 708  
  • Mass: 80593
• Sequence:

  MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTC
  LELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFV
  NHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGS
  TNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIP
  LHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEP
  FSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLT
  ERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTR
  ARALRSQSEESASAFSADDLMSIDLAEQMANDSDDSISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLE
  TSTRSRNSKTAVSASRNMSIIDAFKSTRQQPSRNVTTKNYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSKIM
  SQSQVSKGVDFESSEDDDDDPFMNTSSLRRNRR

• Structural information:
  • Interpro: IPR004843  IPR029052  IPR003701  IPR007281  IPR038487   IPR041796  
  • CDD: cd00840
  • PDB: 3T1I
  • PDBsum: 3T1I
  • DIP: 33238
  • STRING: ENSP00000325863
• Other Databases: GeneCards:  MRE11  Malacards:  MRE11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004520	endodeoxyribonuclease activity	IDA	molecular function
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0000014	single-stranded DNA endodeoxyribonuclease activity	IDA	molecular function
GO:0006303	double-strand break repair via nonhomologous end joining	IDA	biological process
GO:0042138	meiotic DNA double-strand break formation	IBA	biological process
GO:0008296	3'-5'-exodeoxyribonuclease activity	IBA	molecular function
GO:0007095	mitotic G2 DNA damage checkpoint	IBA	biological process
GO:0006303	double-strand break repair via nonhomologous end joining	IBA	biological process
GO:0000723	telomere maintenance	IBA	biological process
GO:0097552	mitochondrial double-strand break repair via homologous recombination	IBA	biological process
GO:0035861	site of double-strand break	IBA	cellular component
GO:0031573	intra-S DNA damage checkpoint	IBA	biological process
GO:0030870	Mre11 complex	IBA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IBA	colocalizes with
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0000014	single-stranded DNA endodeoxyribonuclease activity	IBA	molecular function
GO:0035861	site of double-strand break	IDA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0110025	DNA strand resection involved in replication fork processing	IDA	biological process
GO:0008409	5'-3' exonuclease activity	IDA	molecular function
GO:0035861	site of double-strand break	IDA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IDA	biological process
GO:0005657	replication fork	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030145	manganese ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006302	double-strand break repair	IEA	biological process
GO:0008408	3'-5' exonuclease activity	IEA	molecular function
GO:0030870	Mre11 complex	IEA	cellular component
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0000014	single-stranded DNA endodeoxyribonuclease activity	TAS	molecular function
GO:0008408	3'-5' exonuclease activity	TAS	molecular function
GO:0003690	double-stranded DNA binding	TAS	molecular function
GO:0004520	endodeoxyribonuclease activity	TAS	molecular function
GO:0000019	regulation of mitotic recombination	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006302	double-strand break repair	TAS	biological process
GO:0006310	DNA recombination	TAS	biological process
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0006303	double-strand break repair via nonhomologous end joining	TAS	biological process
GO:0007004	telomere maintenance via telomerase	TAS	biological process
GO:0007004	telomere maintenance via telomerase	TAS	biological process
GO:0030870	Mre11 complex	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0000724	double-strand break repair via homologous recombination	TAS	biological process
GO:0000729	DNA double-strand break processing	TAS	biological process
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0004520	endodeoxyribonuclease activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006303	double-strand break repair via nonhomologous end joining	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051276	chromosome organization	IEA	biological process
GO:0031573	intra-S DNA damage checkpoint	IEA	biological process
GO:0016605	PML body	IEA	cellular component
GO:0008283	cell population proliferation	IEA	biological process
GO:0006302	double-strand break repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IEA	cellular component
GO:0007129	synapsis	IEA	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IEA	biological process
GO:0016605	PML body	IDA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0000784	nuclear chromosome, telomeric region	ISS	colocalizes with
GO:0016605	PML body	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0031860	telomeric 3' overhang formation	IMP	biological process
GO:0003678	DNA helicase activity	IMP	contributes to
GO:0004518	nuclease activity	TAS	molecular function
GO:0003677	DNA binding	IDA	contributes to
GO:0045296	cadherin binding	HDA	molecular function
GO:0000781	chromosome, telomeric region	IDA	colocalizes with
GO:0031954	positive regulation of protein autophosphorylation	IDA	biological process
GO:0033674	positive regulation of kinase activity	IDA	biological process
GO:0007062	sister chromatid cohesion	IMP	biological process
GO:0032508	DNA duplex unwinding	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030870	Mre11 complex	NAS	cellular component
GO:0030870	Mre11 complex	TAS	cellular component
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence
hsa03440	Homologous recombination
hsa03450	Non-homologous end-joining

Diseases

Associated diseases	References
Immunodeficiency associated with DNA repair defects	KEGG:H00094
Ataxia-telangiectasia-like syndrome	KEGG:H02014
Immunodeficiency associated with DNA repair defects	KEGG:H00094
Ataxia-telangiectasia-like syndrome	KEGG:H02014
Alzheimer's disease	PMID:15337312
urinary bladder cancer	PMID:18638378
Endometrial cancer	PMID:15048091
Astrocytoma	PMID:17034947
Breast carcinoma	PMID:14511253
Breast carcinoma	PMID:19383352
stomach carcinoma	PMID:15319296
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881