• Gene id: 4357

Gene Summary

• Gene Symbol: MPST   Gene   UCSC   Ensembl
• Aliases: MST, TST2, TUM1
• Gene name: mercaptopyruvate sulfurtransferase
• Alternate names: 3-mercaptopyruvate sulfurtransferase, human liver rhodanese, tRNA thiouridin modification protein 1, testicular tissue protein Li 200,
• Gene location: 22q12.3 (37019741: 37029814)     Exons: 6     NC_000022.11
• Gene summary(Entrez): This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this prot
• OMIM: 600292

Protein Summary

• Protein general information: P25325  
  • Name: 3 mercaptopyruvate sulfurtransferase (MST) (EC 2.8.1.2)
  • Length: 297  
  • Mass: 33178
• Sequence:

  MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHM
  LPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPA
  PAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKS
  PEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH

• Structural information:
  • Protein Domains: (25..14-)
    (/note="Rhodanese-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (174..28-)
    (/note="Rhodanese-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173"-)
  • Interpro: IPR001763  IPR036873  IPR001307  
  • Prosite: PS00380 PS00683 PS50206
  • PDB: 3OLH 4JGT
  • PDBsum: 3OLH 4JGT
  • DIP: 613
  • STRING: ENSP00000380402
• Other Databases: GeneCards:  MPST  Malacards:  MPST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019346	transsulfuration	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0004792	thiosulfate sulfurtransferase activity	IBA	molecular function
GO:0070814	hydrogen sulfide biosynthetic process	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0016784	3-mercaptopyruvate sulfurtransferase activity	ISS	molecular function
GO:0004792	thiosulfate sulfurtransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0004792	thiosulfate sulfurtransferase activity	TAS	molecular function
GO:0009440	cyanate catabolic process	TAS	biological process
GO:0009636	response to toxic substance	TAS	biological process
GO:0016784	3-mercaptopyruvate sulfurtransferase activity	IEA	molecular function
GO:0000098	sulfur amino acid catabolic process	TAS	biological process
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0016784	3-mercaptopyruvate sulfurtransferase activity	TAS	molecular function
GO:0016784	3-mercaptopyruvate sulfurtransferase activity	TAS	molecular function
GO:0016784	3-mercaptopyruvate sulfurtransferase activity	TAS	molecular function
GO:0016784	3-mercaptopyruvate sulfurtransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0070814	hydrogen sulfide biosynthetic process	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0021510	spinal cord development	IEA	biological process
GO:0016784	3-mercaptopyruvate sulfurtransferase activity	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0004792	thiosulfate sulfurtransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0019346	transsulfuration	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism
hsa00920	Sulfur metabolism
hsa04122	Sulfur relay system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray