• Gene id: 4354

Gene Summary

• Gene Symbol: MPP1   Gene   UCSC   Ensembl
• Aliases: AAG12, DXS552E, EMP55, MRG1, PEMP
• Gene name: membrane palmitoylated protein 1
• Alternate names: 55 kDa erythrocyte membrane protein, aging-associated gene 12, erythrocyte membrane protein p55, membrane protein, palmitoylated 1, 55kDa, migration-related gene 1, p55, palmitoylated erythrocyte membrane protein,
• Gene location: Xq28 (154805526: 154778683)     Exons: 13     NC_000023.11
• Gene summary(Entrez): This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensiv

Protein Summary

• Protein general information: Q00013  
  • Name: 55 kDa erythrocyte membrane protein (p55) (Membrane protein, palmitoylated 1)
  • Length: 466  
  • Mass: 52296
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFE
  KVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIP
  NQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQE
  WRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKN
  ALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKI
  AILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF
  DQACSSPQWVPVSWVY

• Structural information:
  • Protein Domains: (71..15-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (158..22-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (282..45-)
    (/note="Guanylate-kinase-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU-)
  • Interpro: IPR008145  IPR008144  IPR020590  IPR035475  IPR027417   IPR001478  IPR036034  IPR036028  IPR001452  
  • Prosite: PS00856 PS50052 PS50106 PS50002
  • CDD: cd12080
  • PDB: 2EJY 2EV8 3NEY
  • PDBsum: 2EJY 2EV8 3NEY
  • STRING: ENSP00000358547
• Other Databases: GeneCards:  MPP1  Malacards:  MPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090022	regulation of neutrophil chemotaxis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004385	guanylate kinase activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090022	regulation of neutrophil chemotaxis	IEA	biological process
GO:0030863	cortical cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032420	stereocilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0046710	GDP metabolic process	IEA	biological process
GO:0046037	GMP metabolic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881