• Gene id: 4353

Gene Summary

• Gene Symbol: MPO   Gene   UCSC   Ensembl
• Gene name: myeloperoxidase
• Alternate names: myeloperoxidase,
• Gene location: 17q22 (58280934: 58269854)     Exons: 12     NC_000017.11
• Gene summary(Entrez): Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heav
• OMIM: 604543

Protein Summary

• Protein general information: P05164  
  • Name: Myeloperoxidase (MPO) (EC 1.11.2.2) [Cleaved into: Myeloperoxidase; 89 kDa myeloperoxidase; 84 kDa myeloperoxidase; Myeloperoxidase light chain; Myeloperoxidase heavy chain]
  • Length: 745  
  • Mass: 83869
• Sequence:

  MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAKQLVDK
  AYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLHVALDLLERKLRSLWRRPFNVTDVLTPAQLN
  VLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVA
  LARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
  PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRA
  LLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIV
  GAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRV
  PLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
  AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDG
  DRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS

• Structural information:
  • Interpro: IPR019791  IPR010255  IPR037120  IPR029609  
  • Prosite: PS00435 PS50292
  • PDB: 1CXP 1D2V 1D5L 1D7W 1DNU 1DNW 1MHL 1MYP 3F9P 3ZS0 3ZS1 4C1M 4DL1 4EJX 5FIW 5MFA 5UZU 6AZP 6BMT
  • PDBsum: 1CXP 1D2V 1D5L 1D7W 1DNU 1DNW 1MHL 1MYP 3F9P 3ZS0 3ZS1 4C1M 4DL1 4EJX 5FIW 5MFA 5UZU 6AZP 6BMT
  • STRING: ENSP00000225275
• Other Databases: GeneCards:  MPO  Malacards:  MPO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004601	peroxidase activity	IDA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0004601	peroxidase activity	IBA	molecular function
GO:0042742	defense response to bacterium	IBA	biological process
GO:0002149	hypochlorous acid biosynthetic process	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0006952	defense response	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0004601	peroxidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0003682	chromatin binding	TAS	molecular function
GO:0004601	peroxidase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006979	response to oxidative stress	TAS	biological process
GO:0005764	lysosome	TAS	cellular component
GO:0006952	defense response	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0004601	peroxidase activity	IDA	molecular function
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0045454	cell redox homeostasis	TAS	biological process
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0002679	respiratory burst involved in defense response	IEA	biological process
GO:0001878	response to yeast	IEA	biological process
GO:1990268	response to gold nanoparticle	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0050832	defense response to fungus	IEA	biological process
GO:0019430	removal of superoxide radicals	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0002149	hypochlorous acid biosynthetic process	IEA	biological process
GO:0032094	response to food	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0034374	low-density lipoprotein particle remodeling	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0042582	azurophil granule	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0006979	response to oxidative stress	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer
hsa04145	Phagosome
hsa00983	Drug metabolism - other enzymes
hsa05221	Acute myeloid leukemia

Diseases

Associated diseases	References
Myeloperoxidase deficiency	KEGG:H02025
Other phagocyte defects	KEGG:H00101
Myeloperoxidase deficiency	KEGG:H02025
Lupus nephritis	PMID:17896805
cardiovascular system disease	PMID:12694338
lung cancer	PMID:15718477
Cystic fibrosis	PMID:20954832
Cystic fibrosis	PMID:16883063
Keratosis	PMID:14580687
pancreatic cancer	PMID:18205184
Asthma	PMID:10731862
Asthma	PMID:19544176
Interstitial lung disease	PMID:17643278
Chronic obstructive pulmonary disease	PMID:10917466
Lung disease	PMID:19483113
status asthmaticus	PMID:10731862
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881