• Gene id: 4350

Gene Summary

• Gene Symbol: MPG   Gene   UCSC   Ensembl
• Aliases: AAG, ADPG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg
• Gene name: N-methylpurine DNA glycosylase
• Alternate names: DNA-3-methyladenine glycosylase, 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on 16p, 3-alkyladenine DNA glycosylase, 3-methyladenine DNA glycosidase, CRA36.1 (3-methyl-adenine DNA glycosylase), N-methylpurine-DNA glycosylas,
• Gene location: 16p13.3 (77018: 85850)     Exons: 6     NC_000016.10
• OMIM: 156565

Protein Summary

• Protein general information: P29372  
  • Name: DNA 3 methyladenine glycosylase (EC 3.2.2.21) (3 alkyladenine DNA glycosylase) (3 methyladenine DNA glycosidase) (ADPG) (N methylpurine DNA glycosylase)
  • Length: 298  
  • Mass: 32,869
• Sequence:

  MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIY
  FSSPKGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMF
  MKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQAL
  AINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

• Structural information:
  • Interpro: IPR011034  IPR003180  IPR036995  
  • CDD: cd00540
  • PDB: 1BNK 1EWN 1F4R 1F6O 3QI5 3UBY
  • PDBsum: 1BNK 1EWN 1F4R 1F6O 3QI5 3UBY
  • STRING: ENSP00000219431
• Other Databases: GeneCards:  MPG  Malacards:  MPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003684	damaged DNA binding	TAS	molecular function
GO:0003905	alkylbase DNA N-glycosylase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006284	base-excision repair	TAS	biological process
GO:0006307	DNA dealkylation involved in DNA repair	TAS	biological process
GO:0008725	DNA-3-methyladenine glycosylase activity	IEA	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0043916	DNA-7-methylguanine glycosylase activity	IEA	molecular function
GO:0045007	depurination	TAS	biological process
GO:0045007	depurination	TAS	biological process
GO:0052821	DNA-7-methyladenine glycosylase activity	IEA	molecular function
GO:0052822	DNA-3-methylguanine glycosylase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003684	damaged DNA binding	TAS	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0003905	alkylbase DNA N-glycosylase activity	IEA	molecular function
GO:0003905	alkylbase DNA N-glycosylase activity	IEA	molecular function
GO:0003905	alkylbase DNA N-glycosylase activity	IEA	molecular function
GO:0003905	alkylbase DNA N-glycosylase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006284	base-excision repair	IEA	biological process
GO:0006284	base-excision repair	IEA	biological process
GO:0006284	base-excision repair	TAS	biological process
GO:0006307	DNA dealkylation involved in DNA repair	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008725	DNA-3-methyladenine glycosylase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0043916	DNA-7-methylguanine glycosylase activity	IEA	molecular function
GO:0045007	depurination	TAS	biological process
GO:0045007	depurination	TAS	biological process
GO:0052821	DNA-7-methyladenine glycosylase activity	IEA	molecular function
GO:0052822	DNA-3-methylguanine glycosylase activity	IEA	molecular function
GO:0003684	damaged DNA binding	TAS	molecular function
GO:0003905	alkylbase DNA N-glycosylase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006284	base-excision repair	TAS	biological process
GO:0006307	DNA dealkylation involved in DNA repair	TAS	biological process
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0045007	depurination	TAS	biological process
GO:0045007	depurination	TAS	biological process

Diseases

Associated diseases	References
Cancer (bladder)	GAD: 19237606
Cancer	GAD: 16195237
Cancer (Hematologic)	GAD: 20226869
Cancer (lung)	GAD: 16195237
Cancer (breast)	GAD: 19183483
Multiple sclerosis	GAD: 20522537
Arthritis	GAD: 21063071
Ovarian tumorigenesis	INFBASE: 12014652
Ovarian tumorigenesis	INFBASE: 12014652
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility, ovarian tumorigenesis	MIK: 12014652

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12014652	Male infertility, ovarian tumorigenesis				Male infertility	MPG
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq