• Gene id: 4342

Gene Summary

• Gene Symbol: MOS   Gene   UCSC   Ensembl
• Aliases: MSV
• Gene name: MOS proto-oncogene, serine/threonine kinase
• Alternate names: proto-oncogene serine/threonine-protein kinase mos, c-mos, oncogene MOS, Moloney murine sarcoma virus, oocyte maturation factor mos, proto-oncogene c-Mos, v-mos Moloney murine sarcoma viral oncogene homolog,
• Gene location: 8q12.1 (56113981: 56112941)     Exons: 1     NC_000008.11
• Gene summary(Entrez): MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM, Jul 2009]
• OMIM: 607849

Protein Summary

• Protein general information: P00540  
  • Name: Proto oncogene serine/threonine protein kinase mos (EC 2.7.11.1) (Oocyte maturation factor mos) (Proto oncogene c Mos)
  • Length: 346  
  • Mass: 37820
  • Tissue specificity: Expressed specifically in testis during spermatogenesis.
• Sequence:

  MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVY
  KATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQV
  IYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEK
  LEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
  AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG

• Structural information:
  • Protein Domains: (60..34-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000310722
• Other Databases: GeneCards:  MOS  Malacards:  MOS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:1902103	negative regulation of metaphase/anaphase transition of meiotic cell cycle	IBA	biological process
GO:0004672	protein kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000212	meiotic spindle organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0040020	regulation of meiotic nuclear division	IEA	biological process
GO:0051296	establishment of meiotic spindle orientation	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:1902103	negative regulation of metaphase/anaphase transition of meiotic cell cycle	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:1902103	negative regulation of metaphase/anaphase transition of meiotic cell cycle	ISS	biological process
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0051296	establishment of meiotic spindle orientation	ISS	biological process
GO:0046777	protein autophosphorylation	ISS	biological process
GO:0006325	chromatin organization	ISS	biological process
GO:0004709	MAP kinase kinase kinase activity	ISS	molecular function
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0000212	meiotic spindle organization	ISS	biological process
GO:0000186	activation of MAPKK activity	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881