Search Result
Gene id | 4340 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | MOG Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | BTN6, BTNL11, MOGIG2, NRCLP7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | myelin oligodendrocyte glycoprotein | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | myelin-oligodendrocyte glycoprotein, MOG AluA, MOG AluB, MOG Ig-AluB, MOG alpha-5, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
6p22.1 (29657091: 29672364) Exons: 9 NC_000006.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 159465 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q16653 Name: Myelin oligodendrocyte glycoprotein Length: 247 Mass: 28193 Tissue specificity: Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSR VVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYW VSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALI ICYNWLHRRLAGQFLEELRNPF | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: MOG Malacards: MOG | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|