• Gene id: 4340

Gene Summary

• Gene Symbol: MOG   Gene   UCSC   Ensembl
• Aliases: BTN6, BTNL11, MOGIG2, NRCLP7
• Gene name: myelin oligodendrocyte glycoprotein
• Alternate names: myelin-oligodendrocyte glycoprotein, MOG AluA, MOG AluB, MOG Ig-AluB, MOG alpha-5,
• Gene location: 6p22.1 (29657091: 29672364)     Exons: 9     NC_000006.12
• Gene summary(Entrez): The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may
• OMIM: 159465

Protein Summary

• Protein general information: Q16653  
  • Name: Myelin oligodendrocyte glycoprotein
  • Length: 247  
  • Mass: 28193
  • Tissue specificity: Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.
• Sequence:

  MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSR
  VVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYW
  VSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALI
  ICYNWLHRRLAGQFLEELRNPF

• Structural information:
  • Protein Domains: (32..14-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR016663  
  • Prosite: PS50835
  • PDB: 1Q70
  • PDBsum: 1Q70
  • STRING: ENSP00000366095
• Other Databases: GeneCards:  MOG  Malacards:  MOG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0050776	regulation of immune response	IBA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0007417	central nervous system development	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process

Diseases

Associated diseases	References
Narcolepsy	KEGG:H01293
Narcolepsy	KEGG:H01293
optic neuritis	PMID:22157536
Multiple sclerosis	PMID:17142321
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881