• Gene id: 4336

Gene Summary

• Gene Symbol: MOBP   Gene   UCSC   Ensembl
• Gene name: myelin associated oligodendrocyte basic protein
• Alternate names: myelin-associated oligodendrocyte basic protein,
• Gene location: 3p22.1 (39467679: 39529496)     Exons: 7     NC_000003.12
• OMIM: 606091

Protein Summary

• Protein general information: Q13875  
  • Name: Myelin associated oligodendrocyte basic protein
  • Length: 183  
  • Mass: 20959
• Sequence:

  MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRTSRRAK
  SPQRPKQQPAAPPAVVRAPAKPRSPPRSERQPRSPPRSERQPRSPPRSERQPRSPPRSERQPRPRPEVRPPPAKQ
  RPPQKSKQQPRSSPLRGPGASRGGSPVKASRFW

• Structural information:
  • Interpro: IPR041282  IPR013083  
• Other Databases: GeneCards:  MOBP  Malacards:  MOBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0003779	actin binding	IBA	molecular function
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0017022	myosin binding	IBA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019911	structural constituent of myelin sheath	IEA	molecular function
GO:0019911	structural constituent of myelin sheath	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R