• Gene id: 4327

Gene Summary

• Gene Symbol: MMP19   Gene   UCSC   Ensembl
• Aliases: CODA, MMP18, RASI-1
• Gene name: matrix metallopeptidase 19
• Alternate names: matrix metalloproteinase-19, matrix metalloproteinase RASI, matrix metalloproteinase-18, matrix metalloproteinase-beta19,
• Gene location: 12q13.2 (55842970: 55835432)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of a family of proteins that are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as a
• OMIM: 605729

Protein Summary

• Protein general information: Q99542  
  • Name: Matrix metalloproteinase 19 (MMP 19) (EC 3.4.24. ) (Matrix metalloproteinase RASI) (Matrix metalloproteinase 18) (MMP 18)
  • Length: 508  
  • Mass: 57357
  • Tissue specificity: Expressed in mammary gland, placenta, lung, pancreas, ovary, small intestine, spleen, thymus, prostate, testis colon, heart and blood vessel walls. Not detected in brain and peripheral blood leukocytes. Also expressed in the synovial f
• Sequence:

  MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDA
  TRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAG
  AADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRY
  SQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGP
  RGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNR
  VEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWR
  LNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR033739  IPR024079   IPR028724  IPR001818  IPR021190  IPR006026  IPR002477  IPR036365  
  • Prosite: PS51642 PS00142
  • CDD: cd00094 cd04278
  • STRING: ENSP00000313437
• Other Databases: GeneCards:  MMP19  Malacards:  MMP19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0030574	collagen catabolic process	IBA	biological process
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0030574	collagen catabolic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	EXP	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0001554	luteolysis	IEA	biological process
GO:0001542	ovulation from ovarian follicle	IEA	biological process
GO:0001541	ovarian follicle development	IEA	biological process
GO:0006508	proteolysis	NAS	biological process
GO:0031012	extracellular matrix	NAS	cellular component

Diseases

Associated diseases	References
Cavitary optic disc anomalies	KEGG:H02270
Cavitary optic disc anomalies	KEGG:H02270
Multiple sclerosis	PMID:11438176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881