• Gene id: 4326

Gene Summary

• Gene Symbol: MMP17   Gene   UCSC   Ensembl
• Aliases: MMP-17, MT4-MMP, MT4MMP, MTMMP4
• Gene name: matrix metallopeptidase 17
• Alternate names: matrix metalloproteinase-17, MT-MMP 4, matrix metallopeptidase 17 (membrane-inserted), matrix metalloproteinase 17 (membrane-inserted), membrane-type matrix metalloproteinase 4, membrane-type-4 matrix metalloproteinase,
• Gene location: 12q24.33 (131828392: 131851770)     Exons: 14     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the peptidase M10 family and membrane-type subfamily of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic deve
• OMIM: 608310

Protein Summary

• Protein general information: Q9ULZ9  
  • Name: Matrix metalloproteinase 17 (MMP 17) (EC 3.4.24. ) (Membrane type matrix metalloproteinase 4) (MT MMP 4) (MTMMP4) (Membrane type 4 matrix metalloproteinase) (MT4 MMP) (MT4MMP)
  • Length: 603  
  • Mass: 66653
  • Tissue specificity: Expressed in brain, leukocytes, colon, ovary testis and breast cancer. Expressed also in many transformed and non-transformed cell types.
• Sequence:

  MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFGYLPPADPTTGQLQTQ
  EELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSP
  LGHDTVRALMYYALKVWSDIAPLNFHEVAGSAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFD
  DDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESV
  SPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFW
  RGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQL
  YWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGD
  SQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQA
  LTL

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR033739  IPR024079   IPR028726  IPR001818  IPR021190  IPR006026  IPR002477  IPR036365  
  • Prosite: PS51642 PS00142
  • CDD: cd00094 cd04278
  • STRING: ENSP00000353767
• Other Databases: GeneCards:  MMP17  Malacards:  MMP17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070006	metalloaminopeptidase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0030574	collagen catabolic process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0042756	drinking behavior	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04928	Parathyroid hormone synthesis, secretion and action

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray