• Gene id: 4325

Gene Summary

• Gene Symbol: MMP16   Gene   UCSC   Ensembl
• Aliases: C8orf57, MMP-X2, MT-MMP2, MT-MMP3, MT3-MMP
• Gene name: matrix metallopeptidase 16
• Alternate names: matrix metalloproteinase-16, MMP-16, MT-MMP 3, MT3MMP, MTMMP3, Putative transmembrane protein C8orf57, matrix metallopeptidase 16 (membrane-inserted), membrane-type matrix metalloproteinase 3, membrane-type-3 matrix metalloproteinase,
• Gene location: 8q21.3 (88327482: 88032008)     Exons: 6     NC_000008.11
• Gene summary(Entrez): Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
• OMIM: 602262

Protein Summary

• Protein general information: P51512  
  • Name: Matrix metalloproteinase 16 (MMP 16) (EC 3.4.24. ) (MMP X2) (Membrane type matrix metalloproteinase 3) (MT MMP 3) (MTMMP3) (Membrane type 3 matrix metalloproteinase) (MT3 MMP) (MT3MMP)
  • Length: 607  
  • Mass: 69521
  • Tissue specificity: Expressed in heart, brain, placenta, ovary and small intestine. Isoform Short is found in the ovary.
• Sequence:

  MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAA
  MQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRK
  AIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD
  EPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
  RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMD
  GYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGK
  TYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSI
  LKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
  RSMQEWV

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR018486  IPR033739   IPR024079  IPR028697  IPR001818  IPR021190  IPR021805  IPR021158  IPR006026  IPR002477  IPR036365  
  • Prosite: PS00546 PS00024 PS51642 PS00142
  • CDD: cd00094 cd04278
  • PDB: 1RM8
  • PDBsum: 1RM8
  • STRING: ENSP00000286614
• Other Databases: GeneCards:  MMP16  Malacards:  MMP16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0004222	metalloendopeptidase activity	IDA	molecular function
GO:0070006	metalloaminopeptidase activity	IDA	molecular function
GO:0070006	metalloaminopeptidase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0016485	protein processing	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0019538	protein metabolic process	TAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0001501	skeletal system development	IBA	biological process
GO:0030574	collagen catabolic process	IBA	biological process
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030574	collagen catabolic process	IEA	biological process
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0060348	bone development	IEA	biological process
GO:0035988	chondrocyte proliferation	IEA	biological process
GO:0030574	collagen catabolic process	IEA	biological process
GO:0097094	craniofacial suture morphogenesis	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IEA	biological process
GO:0001958	endochondral ossification	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa04928	Parathyroid hormone synthesis, secretion and action

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)