• Gene id: 4324

Gene Summary

• Gene Symbol: MMP15   Gene   UCSC   Ensembl
• Aliases: MMP-15, MT2-MMP, MT2MMP, MTMMP2, SMCP-2
• Gene name: matrix metallopeptidase 15
• Alternate names: matrix metalloproteinase-15, MT-MMP 2, matrix metallopeptidase 15 (membrane-inserted), matrix metalloproteinase 15 (membrane-inserted), membrane-type matrix metalloproteinase 2, membrane-type-2 matrix metalloproteinase,
• Gene location: 16q21 (140596528: 140647410)     Exons: 14     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the peptidase M10 family and membrane-type subfamily of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic deve
• OMIM: 602261

Protein Summary

• Protein general information: P51511  
  • Name: Matrix metalloproteinase 15 (MMP 15) (EC 3.4.24. ) (Membrane type matrix metalloproteinase 2) (MT MMP 2) (MTMMP2) (Membrane type 2 matrix metalloproteinase) (MT2 MMP) (MT2MMP) (SMCP 2)
  • Length: 669  
  • Mass: 75807
  • Tissue specificity: Appeared to be synthesized preferentially in liver, placenta, testis, colon and intestine. Substantial amounts are also detected in pancreas, kidney, lung, heart and skeletal muscle.
• Sequence:

  MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLYGYLPQPSRHMSTMRS
  AQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVRVKANLRRRRKRYALTGRKWNNHHLTFSIQN
  YTEKLGWYHSMEAVRRAFRVWEQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFP
  GPGLGGDTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKLPEDDLRGIQ
  QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPVQPRATERPDQYGPNICDGDFD
  TVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGY
  PQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAY
  TYFYKGTKYWKFDNERLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGD
  FGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQRKGAPRVLLYCKRSLQEWV

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR018486  IPR033739   IPR024079  IPR028729  IPR001818  IPR021190  IPR021805  IPR021158  IPR006026  IPR002477  IPR036365  
  • Prosite: PS00546 PS00024 PS51642 PS00142
  • CDD: cd00094 cd04278
  • STRING: ENSP00000219271
• Other Databases: GeneCards:  MMP15  Malacards:  MMP15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070006	metalloaminopeptidase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0030574	collagen catabolic process	IBA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030574	collagen catabolic process	TAS	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032355	response to estradiol	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0035987	endodermal cell differentiation	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04928	Parathyroid hormone synthesis, secretion and action

Diseases

Associated diseases	References
Prostate cancer	PMID:15928670
Transitional cell carcinoma	PMID:9751409
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq