• Gene id: 4323

Gene Summary

• Gene Symbol: MMP14   Gene   UCSC   Ensembl
• Aliases: MMP-14, MMP-X1, MT-MMP, MT-MMP 1, MT1-MMP, MT1MMP, MTMMP1, WNCHRS
• Gene name: matrix metallopeptidase 14
• Alternate names: matrix metalloproteinase-14, matrix metallopeptidase 14 (membrane-inserted), membrane type 1 metalloprotease, membrane-type-1 matrix metalloproteinase,
• Gene location: 14q11.2 (22836584: 22847757)     Exons: 10     NC_000014.9
• Gene summary(Entrez): Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
• OMIM: 600754

Protein Summary

• Protein general information: P50281  
  • Name: Matrix metalloproteinase 14 (MMP 14) (EC 3.4.24.80) (MMP X1) (Membrane type matrix metalloproteinase 1) (MT MMP 1) (MTMMP1) (Membrane type 1 matrix metalloproteinase) (MT1 MMP) (MT1MMP)
  • Length: 582  
  • Mass: 65894
  • Tissue specificity: Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors. {ECO
• Sequence:

  MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQ
  VTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRV
  WESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRN
  EDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
  SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERK
  DGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYP
  KNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVI
  IIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR018486  IPR033739   IPR024079  IPR001818  IPR021190  IPR021805  IPR021158  IPR006026  IPR002477  IPR036365  IPR036366  
  • Prosite: PS00546 PS00024 PS51642 PS00142
  • CDD: cd00094 cd04278
  • PDB: 1BQQ 1BUV 2MQS 3C7X 3MA2 3X23 4P3C 4P3D 4QXU 5H0U 6CLZ 6CM1
  • PDBsum: 1BQQ 1BUV 2MQS 3C7X 3MA2 3X23 4P3C 4P3D 4QXU 5H0U 6CLZ 6CM1
  • DIP: 35111
  • STRING: ENSP00000308208
• Other Databases: GeneCards:  MMP14  Malacards:  MMP14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0070006	metalloaminopeptidase activity	IDA	molecular function
GO:0070006	metalloaminopeptidase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0016485	protein processing	TAS	biological process
GO:0048870	cell motility	TAS	biological process
GO:0001501	skeletal system development	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0030574	collagen catabolic process	IBA	biological process
GO:0031638	zymogen activation	IBA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030307	positive regulation of cell growth	IDA	biological process
GO:0005737	cytoplasm	IDA	colocalizes with
GO:0045746	negative regulation of Notch signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004222	metalloendopeptidase activity	ISS	molecular function
GO:0045579	positive regulation of B cell differentiation	ISS	biological process
GO:0010831	positive regulation of myotube differentiation	ISS	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030574	collagen catabolic process	TAS	biological process
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990834	response to odorant	IEA	biological process
GO:0051895	negative regulation of focal adhesion assembly	IEA	biological process
GO:0048771	tissue remodeling	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0043615	astrocyte cell migration	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0010954	positive regulation of protein processing	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001541	ovarian follicle development	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0097094	craniofacial suture morphogenesis	IEA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IEA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0001958	endochondral ossification	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005178	integrin binding	IEA	molecular function
GO:0001935	endothelial cell proliferation	IEA	biological process
GO:1905523	positive regulation of macrophage migration	IEA	biological process
GO:0060348	bone development	IEA	biological process
GO:0060322	head development	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0035988	chondrocyte proliferation	IEA	biological process
GO:0031638	zymogen activation	IEA	biological process
GO:0030574	collagen catabolic process	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0010831	positive regulation of myotube differentiation	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IMP	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0044354	macropinosome	IDA	cellular component
GO:0031638	zymogen activation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0035987	endodermal cell differentiation	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903076	regulation of protein localization to plasma membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04912	GnRH signaling pathway

Diseases

Associated diseases	References
Winchester syndrome	KEGG:H02089
Winchester syndrome	KEGG:H02089
Intracranial aneurysm	PMID:9724118
Diabetic angiopathy	PMID:12477149
Cardiomyopathy	PMID:11034943
Thoracic aortic aneurysm	PMID:16820601
Marfan syndrome	PMID:16820601
Arteriosclerosis	PMID:12526080
Arteriosclerosis	PMID:10731924
Transitional cell carcinoma	PMID:9751409
Breast carcinoma	PMID:9158005
Myocardial infarction	PMID:16461815
Abdominal aortic aneurysm	PMID:11877705
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq