• Gene id: 4320

Gene Summary

• Gene Symbol: MMP11   Gene   UCSC   Ensembl
• Aliases: SL-3, ST3, STMY3
• Gene name: matrix metallopeptidase 11
• Alternate names: stromelysin-3, matrix metallopeptidase 11 (stromelysin 3), stromelysin III,
• Gene location: 22q11.23 (23772848: 23784315)     Exons: 8     NC_000022.11
• Gene summary(Entrez): Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art
• OMIM: 602836

Protein Summary

• Protein general information: P24347  
  • Name: Stromelysin 3 (SL 3) (ST3) (EC 3.4.24. ) (Matrix metalloproteinase 11) (MMP 11)
  • Length: 488  
  • Mass: 54590
  • Tissue specificity: Specifically expressed in stromal cells of breast carcinomas.
• Sequence:

  MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPAPAPATQEAPRPASSL
  RPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHE
  GRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQH
  TTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
  VSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGAQYWVYDGEKPVLGPA
  PLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAFQDADGYAYFL
  RGRLYWKFDPVKVKALEGFPRLVGPDFFGCAEPANTFL

• Structural information:
  • Interpro: IPR000585  IPR036375  IPR018487  IPR018486  IPR033739   IPR024079  IPR001818  IPR021190  IPR021158  IPR006026  IPR028705  
  • Prosite: PS00546 PS00024 PS51642 PS00142
  • CDD: cd00094 cd04278
  • STRING: ENSP00000215743
• Other Databases: GeneCards:  MMP11  Malacards:  MMP11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0030574	collagen catabolic process	IBA	biological process
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0030574	collagen catabolic process	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0031012	extracellular matrix	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0030574	collagen catabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0071711	basement membrane organization	IEA	biological process
GO:0030574	collagen catabolic process	IEA	biological process
GO:0030199	collagen fibril organization	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881