• Gene id: 4316

Gene Summary

• Gene Symbol: MMP7   Gene   UCSC   Ensembl
• Aliases: MMP-7, MPSL1, PUMP-1
• Gene name: matrix metallopeptidase 7
• Alternate names: matrilysin, matrin, matrix metallopeptidase 7 (matrilysin, uterine), matrix metalloproteinase 7 (matrilysin, uterine), matrix metalloproteinase-7, pump-1 protease, uterine matrilysin, uterine metalloproteinase,
• Gene location: 11q22.2 (102530752: 102520507)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and t
• OMIM: 178990

Protein Summary

• Protein general information: P09237  
  • Name: Matrilysin (EC 3.4.24.23) (Matrin) (Matrix metalloproteinase 7) (MMP 7) (Pump 1 protease) (Uterine metalloproteinase)
  • Length: 267  
  • Mass: 29,677
• Sequence:

  MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLN
  SRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWG
  TADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHS
  SDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

• Structural information:
  • Interpro: IPR033739  IPR028707  IPR024079  IPR001818  IPR021190   IPR021158  IPR006026  IPR002477  IPR036365  
  • Prosite: PS00546 PS00142
  • CDD: cd04278
  • PDB: 1MMP 1MMQ 1MMR 2DDY 2MZE 2MZH 2MZI 2Y6C 2Y6D 5UE2 5UE5
  • PDBsum: 1MMP 1MMQ 1MMR 2DDY 2MZE 2MZH 2MZI 2Y6C 2Y6D 5UE2 5UE5
  • STRING: ENSP00000260227
• Other Databases: GeneCards:  MMP7  Malacards:  MMP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030574	collagen catabolic process	TAS	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0007568	aging	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030574	collagen catabolic process	IEA	biological process
GO:0030574	collagen catabolic process	TAS	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030574	collagen catabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection

Diseases

Associated diseases	References
Cancer (Hepatocellular)	GAD: 18768525
Cancer (cervical)	GAD: 18448157
Cancer (prostate)	GAD: 19303106
Cancer	GAD: 15930031
Cancer (lung)	GAD: 15930031
Cancer	GAD: 20360147
Cancer (colorectal)	GAD: 17125518
Cancer (brain)	GAD: 16956593
Cancer (nasopharyngeal)	GAD: 17607721
Cancer (ovarian)	GAD: 16278009
Cancer (endometrial)	GAD: 20113256
Cancer (bladder)	GAD: 20826916
Astrocytoma	GAD: 17672933
Cancer (thyroid)	GAD: 19730683
Cancer (breast)	GAD: 18648013
Cardiovascular disease	GAD: 11701474
Mucocutaneous lymph node syndrome	GAD: 20230842
Rheumatoid arthritis	GAD: 16356191
Multiple sclerosis	GAD: 18563468
Rheumatoid arthritis	GAD: 17373931
Rheumatoid arthritis	GAD: 16356191
Multiple sclerosis	GAD: 18563468
Endometriosis	INFBASE: 21111772
Genital endometriosis, Female infertility, Endometriosis	INFBASE: 25711032
Endometriosis	INFBASE: 16455621
Endometriosis	INFBASE: 20007614
Abnormal sperm	MIK: 15979995
Chorioamnionitis	GAD: 20452482
Abnormal sperm	MIK: 15979995
Adenomyosis	GAD: 16455621
Implantation failure	INFBASE: 18077318
Adenomyosis	INFBASE: 16455621
Endometriosis	GAD: 16455621
Atrophy	GAD: 19317620
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Abnormal sperm	MIK: 15979995
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15979995	Abnormal sperm				Male infertility	FasL matrilysin
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881