• Gene id: 4313

Gene Summary

• Gene Symbol: MMP2   Gene   UCSC   Ensembl
• Aliases: CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1
• Gene name: matrix metallopeptidase 2
• Alternate names: 72 kDa type IV collagenase, collagenase type IV-A, matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase), matrix metalloproteinase-2, matrix metalloproteinase-II, neutrophil gelatinase,
• Gene location: 16q12.2 (55478829: 55506690)     Exons: 17     NC_000016.10
• Gene summary(Entrez): This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelati
• OMIM: 120360

Protein Summary

• Protein general information: P08253  
  • Name: 72 kDa type IV collagenase (EC 3.4.24.24) (72 kDa gelatinase) (Gelatinase A) (Matrix metalloproteinase 2) (MMP 2) (TBE 1) [Cleaved into: PEX]
  • Length: 660  
  • Mass: 73,882
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLK
  KMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQV
  WSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKY
  GNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
  SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWC
  ATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPD
  IDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYE
  APQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
  GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

• Structural information:
  • Protein Domains: Fibronectin (228-276)
    Fibronectin (286-334)
    Fibronectin (344-392)
  • Interpro: IPR028708  IPR000562  IPR036943  IPR000585  IPR036375   IPR018487  IPR018486  IPR013806  IPR033739  IPR024079  IPR001818  IPR021190  IPR021158  IPR006026  IPR002477  IPR036365  IPR036366  
  • Prosite: PS00546 PS00023 PS51092 PS00024 PS51642 PS00142
  • CDD: cd00062 cd00094 cd04278
  • PDB: 1CK7 1CXW 1EAK 1GEN 1GXD 1HOV 1J7M 1KS0 1QIB 1RTG 3AYU
  • PDBsum: 1CK7 1CXW 1EAK 1GEN 1GXD 1HOV 1J7M 1KS0 1QIB 1RTG 3AYU
  • STRING: ENSP00000219070
• Other Databases: GeneCards:  MMP2  Malacards:  MMP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001955	blood vessel maturation	IEA	biological process
GO:0001957	intramembranous ossification	IEA	biological process
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	EXP	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0008237	metallopeptidase activity	IDA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030017	sarcomere	IEA	cellular component
GO:0030574	collagen catabolic process	TAS	biological process
GO:0035987	endodermal cell differentiation	IEP	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045089	positive regulation of innate immune response	IEA	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0060325	face morphogenesis	IEA	biological process
GO:0060346	bone trabecula formation	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001955	blood vessel maturation	IEA	biological process
GO:0001957	intramembranous ossification	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	EXP	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IDA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030017	sarcomere	IEA	cellular component
GO:0030574	collagen catabolic process	IEA	biological process
GO:0030574	collagen catabolic process	IEA	biological process
GO:0030574	collagen catabolic process	TAS	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0035987	endodermal cell differentiation	IEP	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045089	positive regulation of innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0060325	face morphogenesis	IEA	biological process
GO:0060346	bone trabecula formation	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	EXP	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0008237	metallopeptidase activity	IDA	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030574	collagen catabolic process	TAS	biological process
GO:0035987	endodermal cell differentiation	IEP	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04670	Leukocyte transendothelial migration
hsa04912	GnRH signaling pathway
hsa04915	Estrogen signaling pathway
hsa04926	Relaxin signaling pathway
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05219	Bladder cancer
hsa05418	Fluid shear stress and atherosclerosis
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer (nasal polyps)	GAD: 18711060
Cancer (Squamous cell)	GAD: 19562509
Cancer (stomach)	GAD: 15522165
Cancer (prostate)	GAD: 18398039
Choriocarcinoma	KEGG: H00028
Cancer (penile)	KEGG: H00025
Cancer	GAD: 15250832
Cancer (oral)	GAD: 15250832
Cancer (esophageal)	GAD: 15492291
Cancer (lung)	GAD: 15731163
Cancer (head and neck)	GAD: 16275157
Cancer (colorectal)	GAD: 15485653
Cancer (gastric)	GAD: 12873995
Cancer (melanoma)	GAD: 17958893
Cancer	GAD: 20360147
Cancer (bladder)	GAD: 17178858
Cancer (nasopharyngeal)	GAD: 17607721
Cancer (Hepatocellular)	GAD: 17339256
Cancer (endometrial)	GAD: 20113256
Cancer (cervical)	GAD: 18210196
Cancer (Adenocarcinoma)	GAD: 18253117
Cancer (ovarian)	GAD: 20628624
Cancer (lymphoma)	GAD: 18636124
Cancer (breast)	GAD: 14604886
Aneurysm	GAD: 17182940
Aortic aneurysm	GAD: 15944607
Cardiovascular disease	GAD: 12103254
Atherosclerosis	GAD: 14996438
Abdominal aortic aneurysm	GAD: 15944607
Atrial fibrillation	GAD: 20138860
Carotid artery diseases	GAD: 17901377
Intrauterine growth retardation	GAD: 17367869
Bronchopulmonary dysplasia	GAD: 18784838
Cleft defects	GAD: 20672350
Liver disease	GAD: 15955221
Diabetic retinopathy	GAD: 18552985
Exfoliation syndrome	GAD: 20808730
Myopia	GAD: 20435584
Arthritis	GAD: 11981324
Rheumatoid arthritis	GAD: 16356191
Multiple sclerosis	GAD: 18563468
Multiple sclerosis	GAD: 18835646
Rheumatoid arthritis	GAD: 16755991
Rheumatoid arthritis	GAD: 16356191
Scleroderma	GAD: 20110530
Periodontitis	GAD: 16018746
Periodontitis	GAD: 17448043
Psoriasis	GAD: 12077518
Multiple sclerosis	GAD: 18563468
Psoriasis	GAD: 12077518
Crohn's disease	GAD: 17589947
Arthritis	GAD: 11981324
Crohn's disease	GAD: 17589947
Diabetes	GAD: 19360430
Diabetes	GAD: 18552985
Osteoarthritis	GAD: 12939660
Osteoarthritis	GAD: 12939660
Osteoarthritis	GAD: 18802702
Moyamoya disease	GAD: 20948207
Stroke	GAD: 18560213
Apoplexy	GAD: 20222942
Alzheimer's disease	GAD: 19141999
Alzheimer's disease	GAD: 19141999
Kidney diseases	GAD: 19578796
Kidney diseases	GAD: 19578796
Endometriosis	GAD: 18543216
Endometriosis	GAD: 18543216
Premature ovarian insufficiency (POI)	INFBASE: 25482733
Pelvic endometriosis	INFBASE: 23171686
Recurrent implantation failure (RIF)	INFBASE: 12615834
Female infertility	INFBASE: 24700054
Implantation failure	INFBASE: 19778485
Endometriosis	INFBASE: 21111772
Endometriosis	INFBASE: 18295959
Endometriosis	INFBASE: 12587534
Chronic endometritis	INFBASE: 16984109
Polycystic ovary syndrome (PCOS)	INFBASE: 19368130
Endometriosis	INFBASE: 23364396
Endometriosis	INFBASE: 22985025
Endometrial polyp	INFBASE: 19188819
Endometriosis	INFBASE: 20100617
Endometriosis	INFBASE: 18644593
Endometriosis	INFBASE: 18543216
Female infertility	INFBASE: 18288718
Endometriosis	INFBASE: 18177649
Endometriosis	INFBASE: 16468658
Endometriosis	INFBASE: 12372458
Endometriosis	INFBASE: 12107265
Endometriosis	INFBASE: 11949944
Implantation failure	INFBASE: 23011643
Endometriosis	INFBASE: 20378112
Polycystic ovary syndrome (PCOS)	INFBASE: 16338908
Adenomyosis	INFBASE: 16837781
Leiomyoma	INFBASE: 14597251
Ovarian endometriosis	INFBASE: 15005245
Peritoneal, ovarian and bowel endometriotic tissues	INFBASE: 15452706
Peritoneal, rectovaginal and ovarian endometriosis	INFBASE: 17465288
Polycystic ovary syndrome (PCOS)	INFBASE: 21437624
Polycystic ovary syndrome (PCOS)	INFBASE: 20555001
Polycystic ovary syndrome (PCOS)	INFBASE: 11279294
Unexplained infertility	INFBASE: 12468644
Unexplained infertility	INFBASE: 19778485
Unexplained infertility	INFBASE: 19778485
Uterine endometriosis	INFBASE: 9623791
Male factor infertility	MIK: 26181468
Congenital bilateral absence of the vas deferens (CBAVD)	MIK: 19092444
Male factor infertility	MIK: 26181468
Chorioamnionitis	GAD: 20452482
Congenital bilateral absence of the vas deferens (CBAVD)	MIK: 19092444
Abnormal sperm sample	MIK: 12185105
Implantation failure	INFBASE: 12615834
Endometriosis	INFBASE: 23979130
Female infertility	INFBASE: 23054355
Endometriosis	INFBASE: 22056701
Azoospermia	MIK: 12407049
Endometriosis	INFBASE: 18584412
Impaired reproduction	INFBASE: 18292822
Endometriosis	INFBASE: 15136083
Abnormal sperm sample	MIK: 12185105
Endometriosis	INFBASE: 19055724
Adenomyosis	INFBASE: 19188819
Adenomyosis	INFBASE: 16468658
Chronic obstructive pulmonary disease (COPD)	GAD: 19797132
Nasal polyposis	GAD: 18711060
Connective tissue diseases	GAD: 19527514
Connective tissue diseases	GAD: 19527514
Torg-Winchester syndrome	KEGG: H00472
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Abnormal sperm sample	MIK: 12185105
Azoospermia	MIK: 12407049
Congenital bilateral absence of the vas deferens (CBAVD)	MIK: 19092444
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 26181468

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12407049	Azoospermia			60 (12 normozoospermic, 28 azoospermic, 20 azoospermic after vasectomy )	Male infertility	MMP-2  MMP-9 TIMP-1 and TIMP-2
12185105	Abnormal sperm sample			70 (35 normal sperm samples, 35 abnormal sperm samples)	Male infertility	MMP2 TIMP-1
26181468	Idiopathic male infertility	CLOCK (rs1801260, rs3817444, rs3749474)	Han Chi nese	672 (478 idiopathic infertile men, 194 fertile controls)	Male infertility
19092444	Congenital bilateral absence of the vas deferens (CBAVD)	F508C		850 individuals undergoing cystic fibrosis carrier screening	Male infertility	CFTR
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq