• Gene id: 4303

Gene Summary

• Gene Symbol: FOXO4   Gene   UCSC   Ensembl
• Aliases: AFX, AFX1, MLLT7
• Gene name: forkhead box O4
• Alternate names: forkhead box protein O4, fork head domain transcription factor AFX1, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 7,
• Gene location: Xq13.1 (71095850: 71103533)     Exons: 4     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation
• OMIM: 607939

Protein Summary

• Protein general information: P98177  
  • Name: Forkhead box protein O4 (Fork head domain transcription factor AFX1)
  • Length: 505  
  • Mass: 53684
  • Tissue specificity: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform zeta is most abundant in the liver, kidney, and pancreas.
• Sequence:

  MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHTEGRSEPILLPSRLPE
  PAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGW
  KNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGGKSGKAPRRRAASMDSSSKLLRGRSKAPKKKPSVLPAPPEG
  ATPTSPVGHFAKWSGSPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTL
  NEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTP
  PPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLEAPGPSSLVPTLSMIAPPPVMASAPIPKALG
  TPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDLMDEGEGLDFNFEPDP

• Structural information:
  • Interpro: IPR001766  IPR032067  IPR030456  IPR036388  IPR036390  
  • Prosite: PS00658 PS50039
  • CDD: cd00059
  • PDB: 1E17 3L2C
  • PDBsum: 1E17 3L2C
  • STRING: ENSP00000363377
• Other Databases: GeneCards:  FOXO4  Malacards:  FOXO4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0071158	positive regulation of cell cycle arrest	IDA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0008286	insulin receptor signaling pathway	IBA	biological process
GO:0042593	glucose homeostasis	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048863	stem cell differentiation	IMP	biological process
GO:0043565	sequence-specific DNA binding	IMP	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:0007568	aging	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IEA	biological process
GO:1990785	response to water-immersion restraint stress	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070317	negative regulation of G0 to G1 transition	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0051151	negative regulation of smooth muscle cell differentiation	IDA	biological process
GO:0008286	insulin receptor signaling pathway	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881