• Gene id: 4302

Gene Summary

• Gene Symbol: MLLT6   Gene   UCSC   Ensembl
• Aliases: AF17
• Gene name: MLLT6, PHD finger containing
• Alternate names: protein AF-17, ALL1-fused gene from chromosome 17 protein, MLLT6, PHD finger domain containing, Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 6, myeloid/lymphoid,
• Gene location: 17q12 (38705272: 38729794)     Exons: 20     NC_000017.11
• OMIM: 610597

Protein Summary

• Protein general information: P55198  
  • Name: Protein AF 17 (ALL1 fused gene from chromosome 17 protein)
  • Length: 1093  
  • Mass: 112048
• Sequence:

  MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQACYGIVQVPTGPWFCRKCESQERAARVRCELCPHKDGAL
  KRTDNGGWAHVVCALYIPEVQFANVLTMEPIVLQYVPHDRFNKTCYICEEQGRESKAASGACMTCNRHGCRQAFH
  VTCAQMAGLLCEEEVLEVDNVKYCGYCKYHFSKMKTSRHSSGGGGGGAGGGGGSMGGGGSGFISGRRSRSASPST
  QQEKHPTHHERGQKKSRKDKERLKQKHKKRPESPPSILTPPVVPTADKVSSSASSSSHHEASTQETSESSRESKG
  KKSSSHSLSHKGKKLSSGKGVSSFTSASSSSSSSSSSSGGPFQPAVSSLQSSPDFSAFPKLEQPEEDKYSKPTAP
  APSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFSTTTSSSGRARAPSPGDYKSPHVTGSGASAGTHKRMPALSA
  TPVPADETPETGLKEKKHKASKRSRHGPGRPKGSRNKEGTGGPAAPSLPSAQLAGFTATAASPFSGGSLVSSGLG
  GLSSRTFGPSGSLPSLSLESPLLGAGIYTSNKDPISHSGGMLRAVCSTPLSSSLLGPPGTSALPRLSRSPFTSTL
  PSSSASISTTQVFSLAGSTFSLPSTHIFGTPMGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISS
  LPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERL
  QILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSS
  SSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLL
  GGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQ
  QKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAA
  AGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG

• Structural information:
  • Interpro: IPR034732  IPR019786  IPR011011  IPR001965  IPR019787   IPR013083  
  • Prosite: PS51805 PS01359 PS50016
  • STRING: ENSP00000479910
• Other Databases: GeneCards:  MLLT6  Malacards:  MLLT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031491	nucleosome binding	IDA	molecular function
GO:0042393	histone binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0036359	renal potassium excretion	IEA	biological process
GO:0035812	renal sodium excretion	IEA	biological process
GO:0035811	negative regulation of urine volume	IEA	biological process
GO:0010765	positive regulation of sodium ion transport	IEA	biological process
GO:0007588	excretion	IEA	biological process
GO:2001161	negative regulation of histone H3-K79 methylation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003014	renal system process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0031491	nucleosome binding	IDA	molecular function
GO:0042393	histone binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0036359	renal potassium excretion	IEA	biological process
GO:0035812	renal sodium excretion	IEA	biological process
GO:0035811	negative regulation of urine volume	IEA	biological process
GO:0010765	positive regulation of sodium ion transport	IEA	biological process
GO:0007588	excretion	IEA	biological process
GO:2001161	negative regulation of histone H3-K79 methylation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003014	renal system process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 26361204
Embryo quality	MIK: 26361204

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
26361204	Male infertility, Embryo quality			181 (127 men undergoing IVF treatment, 54 normozoospermic, fertile men)	Male infertility	Microarray